Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 36498..37141 Replicon plasmid 4
Accession NZ_LR882981
Organism Escherichia coli isolate L3_CS7_E2980

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag JLZ94_RS25450 Protein ID WP_001044768.1
Coordinates 36498..36914 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID E9XUD3
Locus tag JLZ94_RS25455 Protein ID WP_001261279.1
Coordinates 36911..37141 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ94_RS25420 31954..32163 - 210 Protein_28 transposase domain-containing protein -
JLZ94_RS25425 32207..32350 + 144 Protein_29 transposase -
JLZ94_RS25430 32581..34119 - 1539 WP_000099207.1 IS66-like element ISEc22 family transposase -
JLZ94_RS25435 34168..34515 - 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -
JLZ94_RS25440 34512..34892 - 381 WP_016241213.1 IS66 family insertion sequence hypothetical protein -
JLZ94_RS25445 35170..35775 - 606 WP_000515888.1 hypothetical protein -
JLZ94_RS25450 36498..36914 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
JLZ94_RS25455 36911..37141 - 231 WP_001261279.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JLZ94_RS25460 37836..38120 + 285 WP_001331078.1 hypothetical protein -
JLZ94_RS25465 38113..38802 + 690 WP_000796232.1 hypothetical protein -
JLZ94_RS25470 38799..39587 + 789 WP_000016497.1 site-specific integrase -
JLZ94_RS25475 39768..40412 + 645 WP_001144036.1 ParA family protein -
JLZ94_RS25480 40499..40807 + 309 WP_000030199.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - etpB / etpA 1..48305 48305


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T290044 WP_001044768.1 NZ_LR882981:c36914-36498 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8761.90 Da        Isoelectric Point: 4.6310

>AT290044 WP_001261279.1 NZ_LR882981:c37141-36911 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPVRPAWGSFAQLEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A3U0EQM4

References