Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3753041..3753878 | Replicon | chromosome |
Accession | NZ_LR882978 | ||
Organism | Escherichia coli isolate L3_CS7_E2980 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | JLZ94_RS18420 | Protein ID | WP_000227784.1 |
Coordinates | 3753336..3753878 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | JLZ94_RS18415 | Protein ID | WP_001297137.1 |
Coordinates | 3753041..3753352 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ94_RS18390 | 3748061..3749008 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
JLZ94_RS18395 | 3749030..3751021 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JLZ94_RS18400 | 3751011..3751625 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JLZ94_RS18405 | 3751625..3751954 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JLZ94_RS18410 | 3751966..3752856 | + | 891 | WP_000971336.1 | heme o synthase | - |
JLZ94_RS18415 | 3753041..3753352 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
JLZ94_RS18420 | 3753336..3753878 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
JLZ94_RS18425 | 3753934..3754869 | - | 936 | WP_001387350.1 | sel1 repeat family protein | - |
JLZ94_RS18430 | 3755277..3756641 | + | 1365 | WP_001000965.1 | MFS transporter | - |
JLZ94_RS18435 | 3756769..3757260 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JLZ94_RS18440 | 3757428..3758339 | + | 912 | WP_000705865.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T290033 WP_000227784.1 NZ_LR882978:3753336-3753878 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|