Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 971108..971762 | Replicon | chromosome |
Accession | NZ_LR882978 | ||
Organism | Escherichia coli isolate L3_CS7_E2980 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | JLZ94_RS04780 | Protein ID | WP_000244772.1 |
Coordinates | 971355..971762 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | JLZ94_RS04775 | Protein ID | WP_000354046.1 |
Coordinates | 971108..971374 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ94_RS04750 | 966396..967139 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
JLZ94_RS04755 | 967196..968629 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
JLZ94_RS04760 | 968674..968985 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
JLZ94_RS04765 | 969149..969808 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
JLZ94_RS04770 | 969885..970865 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
JLZ94_RS04775 | 971108..971374 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
JLZ94_RS04780 | 971355..971762 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
JLZ94_RS04785 | 971802..972323 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
JLZ94_RS04790 | 972435..973331 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
JLZ94_RS04795 | 973356..974066 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
JLZ94_RS04800 | 974072..975805 | + | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T290023 WP_000244772.1 NZ_LR882978:971355-971762 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |