Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 806604..807436 | Replicon | chromosome |
| Accession | NZ_LR882978 | ||
| Organism | Escherichia coli isolate L3_CS7_E2980 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | JLZ94_RS03930 | Protein ID | WP_000854753.1 |
| Coordinates | 806604..806978 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | JLZ94_RS03935 | Protein ID | WP_001278232.1 |
| Coordinates | 807068..807436 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ94_RS03895 | 801671..802270 | + | 600 | WP_001255040.1 | type II secretion system minor pseudopilin GspJ | - |
| JLZ94_RS03900 | 802273..803250 | + | 978 | WP_000633220.1 | type II secretion system minor pseudopilin GspK | - |
| JLZ94_RS03905 | 803247..804425 | + | 1179 | WP_000094974.1 | type II secretion system protein GspL | - |
| JLZ94_RS03910 | 804427..804963 | + | 537 | WP_000942795.1 | GspM family type II secretion system protein YghD | - |
| JLZ94_RS03915 | 805244..805813 | - | 570 | WP_001290243.1 | DUF4942 domain-containing protein | - |
| JLZ94_RS03920 | 805910..806107 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| JLZ94_RS03925 | 806119..806607 | - | 489 | WP_000777541.1 | hypothetical protein | - |
| JLZ94_RS03930 | 806604..806978 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| JLZ94_RS03935 | 807068..807436 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| JLZ94_RS03940 | 807599..807820 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
| JLZ94_RS03945 | 807883..808359 | - | 477 | WP_001186710.1 | RadC family protein | - |
| JLZ94_RS03950 | 808371..808850 | - | 480 | WP_000860064.1 | antirestriction protein | - |
| JLZ94_RS03955 | 808932..809750 | - | 819 | WP_001234631.1 | DUF945 domain-containing protein | - |
| JLZ94_RS03960 | 809850..810083 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| JLZ94_RS03965 | 810162..810617 | - | 456 | WP_000581504.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T290022 WP_000854753.1 NZ_LR882978:c806978-806604 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT290022 WP_001278232.1 NZ_LR882978:c807436-807068 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |