Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 69489..70090 Replicon plasmid 5
Accession NZ_LR882977
Organism Escherichia coli isolate L2_E1649

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag JLZ81_RS24640 Protein ID WP_001216034.1
Coordinates 69489..69869 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag JLZ81_RS24645 Protein ID WP_001190712.1
Coordinates 69869..70090 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ81_RS24615 64930..66414 - 1485 WP_024245508.1 hypothetical protein -
JLZ81_RS24620 66414..67607 - 1194 WP_024245507.1 hypothetical protein -
JLZ81_RS24625 67693..68145 - 453 WP_032227319.1 Late promoter-activating protein -
JLZ81_RS24630 68234..69277 - 1044 WP_001561086.1 DUF968 domain-containing protein -
JLZ81_RS24635 69305..69484 - 180 WP_001339207.1 hypothetical protein -
JLZ81_RS24640 69489..69869 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JLZ81_RS24645 69869..70090 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JLZ81_RS24650 70163..70552 - 390 WP_000506730.1 DNA repair protein -
JLZ81_RS24655 72121..72483 - 363 WP_001261543.1 hypothetical protein -
JLZ81_RS24660 72480..73412 - 933 WP_077899907.1 hypothetical protein -
JLZ81_RS24665 73394..73768 - 375 WP_024236455.1 hypothetical protein -
JLZ81_RS24670 73775..74068 - 294 WP_073516126.1 hypothetical protein -
JLZ81_RS24675 74247..74480 - 234 WP_000517421.1 hypothetical protein -
JLZ81_RS24680 74566..74826 - 261 WP_077899906.1 eaa protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..102017 102017


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T290019 WP_001216034.1 NZ_LR882977:c69869-69489 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT290019 WP_001190712.1 NZ_LR882977:c70090-69869 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References