Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 36537..37062 Replicon plasmid 4
Accession NZ_LR882976
Organism Escherichia coli isolate L2_E1649

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag JLZ81_RS23725 Protein ID WP_001159871.1
Coordinates 36757..37062 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID D7GK94
Locus tag JLZ81_RS23720 Protein ID WP_000829078.1
Coordinates 36537..36755 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JLZ81_RS23695 32096..33046 - 951 WP_001699589.1 virulence factor VirK -
JLZ81_RS23700 33051..34139 - 1089 WP_004100285.1 putative hexosyltransferase CapU -
JLZ81_RS23705 34142..34984 - 843 WP_160371899.1 polysaccharide deacetylase family protein -
JLZ81_RS23710 35228..35758 - 531 WP_011387704.1 hypothetical protein -
JLZ81_RS23715 35758..36015 - 258 WP_000343092.1 hypothetical protein -
JLZ81_RS23720 36537..36755 + 219 WP_000829078.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JLZ81_RS23725 36757..37062 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
JLZ81_RS23730 37063..37869 + 807 WP_000016960.1 site-specific integrase -
JLZ81_RS23735 38047..38691 + 645 WP_001144037.1 ParA family protein -
JLZ81_RS23740 38778..39086 + 309 WP_000030204.1 molecular chaperone GroEL -
JLZ81_RS23745 39296..40526 + 1231 Protein_49 IS66 family transposase -
JLZ81_RS23750 40779..41908 - 1130 Protein_50 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - cs3 / etpB / eltA / eltB 1..120141 120141


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T290018 WP_001159871.1 NZ_LR882976:36757-37062 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8440.51 Da        Isoelectric Point: 6.3212

>AT290018 WP_000829078.1 NZ_LR882976:36537-36755 [Escherichia coli]
MKRRITVTVDSDSYQLLKAYDVNISGLVSTIMQNEARRLRAERWKAENREGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A7ZGP5

References