Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 9604..10129 | Replicon | plasmid 4 |
| Accession | NZ_LR882976 | ||
| Organism | Escherichia coli isolate L2_E1649 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | JLZ81_RS23575 | Protein ID | WP_001159871.1 |
| Coordinates | 9824..10129 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | JLZ81_RS23570 | Protein ID | WP_000813634.1 |
| Coordinates | 9604..9822 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ81_RS23545 | 5240..6190 | - | 951 | WP_001699589.1 | virulence factor VirK | - |
| JLZ81_RS23550 | 6195..7283 | - | 1089 | WP_004100285.1 | putative hexosyltransferase CapU | - |
| JLZ81_RS23555 | 7286..8128 | - | 843 | WP_160371899.1 | polysaccharide deacetylase family protein | - |
| JLZ81_RS23560 | 8372..8902 | - | 531 | WP_011387704.1 | hypothetical protein | - |
| JLZ81_RS23565 | 8902..9159 | - | 258 | WP_000343092.1 | hypothetical protein | - |
| JLZ81_RS23570 | 9604..9822 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| JLZ81_RS23575 | 9824..10129 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| JLZ81_RS23580 | 10130..10843 | + | 714 | WP_000016957.1 | site-specific integrase | - |
| JLZ81_RS23585 | 11173..11814 | + | 642 | WP_001705742.1 | recombinase family protein | - |
| JLZ81_RS23590 | 12254..12933 | - | 680 | Protein_18 | EAL domain-containing protein | - |
| JLZ81_RS23595 | 13181..13884 | + | 704 | Protein_19 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | cs3 / etpB / eltA / eltB | 1..120141 | 120141 | |
| - | flank | IS/Tn | - | - | 11173..11814 | 641 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T290017 WP_001159871.1 NZ_LR882976:9824-10129 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |