Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3447222..3447840 | Replicon | chromosome |
| Accession | NZ_LR882973 | ||
| Organism | Escherichia coli isolate L2_E1649 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | JLZ81_RS16865 | Protein ID | WP_001291435.1 |
| Coordinates | 3447622..3447840 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | JLZ81_RS16860 | Protein ID | WP_000344789.1 |
| Coordinates | 3447222..3447596 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ81_RS16850 | 3442311..3443504 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| JLZ81_RS16855 | 3443527..3446676 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| JLZ81_RS16860 | 3447222..3447596 | + | 375 | WP_000344789.1 | Hha toxicity modulator TomB | Antitoxin |
| JLZ81_RS16865 | 3447622..3447840 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| JLZ81_RS16870 | 3448012..3448563 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| JLZ81_RS16875 | 3448679..3449149 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| JLZ81_RS16880 | 3449313..3450863 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| JLZ81_RS16885 | 3450905..3451258 | - | 354 | WP_000878143.1 | DUF1428 domain-containing protein | - |
| JLZ81_RS16895 | 3451637..3451948 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| JLZ81_RS16900 | 3451979..3452551 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T290009 WP_001291435.1 NZ_LR882973:3447622-3447840 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14569.44 Da Isoelectric Point: 4.7395
>AT290009 WP_000344789.1 NZ_LR882973:3447222-3447596 [Escherichia coli]
MDEYSPKRHDIAQLKFLCEILYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCEILYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|