Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2474298..2474936 | Replicon | chromosome |
| Accession | NZ_LR882973 | ||
| Organism | Escherichia coli isolate L2_E1649 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | JLZ81_RS12070 | Protein ID | WP_000813794.1 |
| Coordinates | 2474760..2474936 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JLZ81_RS12065 | Protein ID | WP_001270286.1 |
| Coordinates | 2474298..2474714 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JLZ81_RS12045 | 2469450..2470391 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| JLZ81_RS12050 | 2470392..2471405 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| JLZ81_RS12055 | 2471423..2472568 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| JLZ81_RS12060 | 2472813..2474219 | - | 1407 | WP_000760586.1 | PLP-dependent aminotransferase family protein | - |
| JLZ81_RS12065 | 2474298..2474714 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JLZ81_RS12070 | 2474760..2474936 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JLZ81_RS12075 | 2475158..2475388 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| JLZ81_RS12080 | 2475480..2477441 | - | 1962 | WP_001355676.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JLZ81_RS12085 | 2477514..2478050 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| JLZ81_RS12090 | 2478103..2479317 | + | 1215 | WP_071597387.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T290008 WP_000813794.1 NZ_LR882973:c2474936-2474760 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT290008 WP_001270286.1 NZ_LR882973:c2474714-2474298 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|