Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 925297..925951 | Replicon | chromosome |
Accession | NZ_LR882973 | ||
Organism | Escherichia coli isolate L2_E1649 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | JLZ81_RS04535 | Protein ID | WP_000244781.1 |
Coordinates | 925544..925951 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | JLZ81_RS04530 | Protein ID | WP_000354046.1 |
Coordinates | 925297..925563 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ81_RS04510 | 921385..922818 | - | 1434 | WP_001394742.1 | 6-phospho-beta-glucosidase BglA | - |
JLZ81_RS04515 | 922863..923174 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
JLZ81_RS04520 | 923338..923997 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
JLZ81_RS04525 | 924074..925054 | - | 981 | WP_000886087.1 | tRNA-modifying protein YgfZ | - |
JLZ81_RS04530 | 925297..925563 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
JLZ81_RS04535 | 925544..925951 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
JLZ81_RS04540 | 925991..926512 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
JLZ81_RS04545 | 926624..927520 | + | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
JLZ81_RS04550 | 927545..928255 | + | 711 | WP_000715224.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
JLZ81_RS04555 | 928261..929994 | + | 1734 | WP_032328035.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T290001 WP_000244781.1 NZ_LR882973:925544-925951 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|