Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 46775..47610 | Replicon | chromosome |
Accession | NZ_LR882973 | ||
Organism | Escherichia coli isolate L2_E1649 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | JLZ81_RS00235 | Protein ID | WP_000854743.1 |
Coordinates | 46775..47152 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | JLZ81_RS00240 | Protein ID | WP_001285298.1 |
Coordinates | 47242..47610 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JLZ81_RS00210 | 42133..43056 | - | 924 | WP_000535961.1 | carboxylate/amino acid/amine transporter | - |
JLZ81_RS00215 | 43167..44351 | - | 1185 | WP_001172882.1 | sugar efflux transporter | - |
JLZ81_RS00220 | 45146..45984 | - | 839 | Protein_43 | DUF4942 domain-containing protein | - |
JLZ81_RS00225 | 46081..46278 | - | 198 | WP_000839275.1 | DUF957 domain-containing protein | - |
JLZ81_RS00230 | 46290..46778 | - | 489 | WP_000761693.1 | hypothetical protein | - |
JLZ81_RS00235 | 46775..47152 | - | 378 | WP_000854743.1 | TA system toxin CbtA family protein | Toxin |
JLZ81_RS00240 | 47242..47610 | - | 369 | WP_001285298.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JLZ81_RS00245 | 47660..48304 | - | 645 | WP_000086754.1 | hypothetical protein | - |
JLZ81_RS00250 | 48323..48544 | - | 222 | WP_000692295.1 | DUF987 domain-containing protein | - |
JLZ81_RS00255 | 48613..49089 | - | 477 | WP_032328266.1 | RadC family protein | - |
JLZ81_RS00260 | 49104..49589 | - | 486 | WP_097344122.1 | antirestriction protein | - |
JLZ81_RS00265 | 49681..50502 | - | 822 | WP_001706654.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14172.08 Da Isoelectric Point: 6.8519
>T289997 WP_000854743.1 NZ_LR882973:c47152-46775 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDSVNFLVEKYALVRTDQPGF
GACTYSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDSVNFLVEKYALVRTDQPGF
GACTYSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|