Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/- |
| Location | 5055007..5055744 | Replicon | chromosome |
| Accession | NZ_LR882967 | ||
| Organism | Planktothrix pseudagardhii strain No.713 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NMK36_RS21815 | Protein ID | WP_254174602.1 |
| Coordinates | 5055007..5055267 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NMK36_RS21820 | Protein ID | WP_254174603.1 |
| Coordinates | 5055406..5055744 (+) | Length | 113 a.a. |
Genomic Context
Location: 5050879..5052771 (1893 bp)
Type: Others
Protein ID: WP_254174600.1
Type: Others
Protein ID: WP_254174600.1
Location: 5054084..5054863 (780 bp)
Type: Others
Protein ID: WP_254174601.1
Type: Others
Protein ID: WP_254174601.1
Location: 5055007..5055267 (261 bp)
Type: Toxin
Protein ID: WP_254174602.1
Type: Toxin
Protein ID: WP_254174602.1
Location: 5055406..5055744 (339 bp)
Type: Antitoxin
Protein ID: WP_254174603.1
Type: Antitoxin
Protein ID: WP_254174603.1
Location: 5056526..5056777 (252 bp)
Type: Others
Protein ID: WP_254174604.1
Type: Others
Protein ID: WP_254174604.1
Location: 5056781..5057203 (423 bp)
Type: Others
Protein ID: WP_254174605.1
Type: Others
Protein ID: WP_254174605.1
Location: 5052768..5053880 (1113 bp)
Type: Others
Protein ID: WP_254172743.1
Type: Others
Protein ID: WP_254172743.1
Location: 5057267..5059927 (2661 bp)
Type: Others
Protein ID: WP_254174606.1
Type: Others
Protein ID: WP_254174606.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK36_RS21800 (NO713_04367) | 5050879..5052771 | + | 1893 | WP_254174600.1 | hypothetical protein | - |
| NMK36_RS21805 (NO713_04368) | 5052768..5053880 | - | 1113 | WP_254172743.1 | IS630 family transposase | - |
| NMK36_RS21810 (NO713_04369) | 5054084..5054863 | + | 780 | WP_254174601.1 | hypothetical protein | - |
| NMK36_RS21815 (NO713_04370) | 5055007..5055267 | + | 261 | WP_254174602.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NMK36_RS21820 (NO713_04371) | 5055406..5055744 | + | 339 | WP_254174603.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NMK36_RS21825 (NO713_04372) | 5056526..5056777 | + | 252 | WP_254174604.1 | DUF2281 domain-containing protein | - |
| NMK36_RS21830 (NO713_04373) | 5056781..5057203 | + | 423 | WP_254174605.1 | PIN domain-containing protein | - |
| NMK36_RS21835 (NO713_04374) | 5057267..5059927 | - | 2661 | WP_254174606.1 | EAL domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 9835.42 Da Isoelectric Point: 11.5333
>T289996 WP_254174602.1 NZ_LR882967:5055007-5055267 [Planktothrix pseudagardhii]
MSLNNKQRRTLELIFTDPIPTTINWQDIENLFQALGATIMQGRGSRIRVLLNNVRAIFHQPHPQKETDRGAVKSVREFLI
KAGVKP
MSLNNKQRRTLELIFTDPIPTTINWQDIENLFQALGATIMQGRGSRIRVLLNNVRAIFHQPHPQKETDRGAVKSVREFLI
KAGVKP
Download Length: 261 bp
Antitoxin
Download Length: 113 a.a. Molecular weight: 12828.57 Da Isoelectric Point: 4.7370
>AT289996 WP_254174603.1 NZ_LR882967:5055406-5055744 [Planktothrix pseudagardhii]
MLNYKGYTAQIEVDVEAGILFGQVLDINDVITFKGKTVEEIRQEFKNSIDDYLEFCQELGQEPDKPFSGKLPFRTTPENH
RKIFLAAKKAGKSINAWMDETLIREANQTIQT
MLNYKGYTAQIEVDVEAGILFGQVLDINDVITFKGKTVEEIRQEFKNSIDDYLEFCQELGQEPDKPFSGKLPFRTTPENH
RKIFLAAKKAGKSINAWMDETLIREANQTIQT
Download Length: 339 bp