Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 3614378..3614972 | Replicon | chromosome |
| Accession | NZ_LR882967 | ||
| Organism | Planktothrix pseudagardhii strain No.713 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NMK36_RS15275 | Protein ID | WP_254174098.1 |
| Coordinates | 3614378..3614737 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NMK36_RS15280 | Protein ID | WP_072719471.1 |
| Coordinates | 3614727..3614972 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK36_RS15245 (NO713_03050) | 3609486..3609719 | - | 234 | WP_072719380.1 | 2Fe-2S iron-sulfur cluster-binding protein | - |
| NMK36_RS15250 (NO713_03051) | 3609744..3611207 | - | 1464 | WP_254174097.1 | cobyric acid synthase CobQ | - |
| NMK36_RS15255 (NO713_03052) | 3611320..3611991 | + | 672 | WP_072719378.1 | uracil phosphoribosyltransferase | - |
| NMK36_RS15260 (NO713_03053) | 3612107..3612403 | + | 297 | WP_072719377.1 | hypothetical protein | - |
| NMK36_RS15265 (NO713_03054) | 3612515..3612805 | + | 291 | WP_072719376.1 | YggT family protein | - |
| NMK36_RS15270 (NO713_03055) | 3612918..3614285 | - | 1368 | WP_072719375.1 | thioredoxin-disulfide reductase | - |
| NMK36_RS15275 (NO713_03056) | 3614378..3614737 | - | 360 | WP_254174098.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMK36_RS15280 (NO713_03057) | 3614727..3614972 | - | 246 | WP_072719471.1 | hypothetical protein | Antitoxin |
| NMK36_RS15285 (NO713_03058) | 3615433..3616122 | + | 690 | WP_254174099.1 | class I SAM-dependent methyltransferase | - |
| NMK36_RS15290 (NO713_03059) | 3616155..3617189 | + | 1035 | WP_072719372.1 | aldo/keto reductase | - |
| NMK36_RS15295 (NO713_03060) | 3617232..3619004 | - | 1773 | WP_254174100.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13631.73 Da Isoelectric Point: 9.7524
>T289995 WP_254174098.1 NZ_LR882967:c3614737-3614378 [Planktothrix pseudagardhii]
MLSEPPPIQIALTPRFKRDLRELAKHYRSIRTDLQPLIEQLQAGEIPGDRIAGIKYTVFKVRLKNSNIQKGKSGGYRVIY
YLKTNQAIILATIYSKSDDSDISHKIIEEVITQYENEIG
MLSEPPPIQIALTPRFKRDLRELAKHYRSIRTDLQPLIEQLQAGEIPGDRIAGIKYTVFKVRLKNSNIQKGKSGGYRVIY
YLKTNQAIILATIYSKSDDSDISHKIIEEVITQYENEIG
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|