Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3218762..3219339 | Replicon | chromosome |
| Accession | NZ_LR882967 | ||
| Organism | Planktothrix pseudagardhii strain No.713 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NMK36_RS13680 | Protein ID | WP_254173966.1 |
| Coordinates | 3218762..3219103 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A1J1LPA2 |
| Locus tag | NMK36_RS13685 | Protein ID | WP_072720577.1 |
| Coordinates | 3219097..3219339 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK36_RS13660 (NO713_02729) | 3214695..3214964 | - | 270 | WP_072720572.1 | hypothetical protein | - |
| NMK36_RS13665 (NO713_02730) | 3215307..3215912 | + | 606 | WP_190522800.1 | NfeD-like protein | - |
| NMK36_RS13670 (NO713_02731) | 3216001..3217329 | + | 1329 | WP_254173964.1 | SPFH domain-containing protein | - |
| NMK36_RS13675 (NO713_02732) | 3217382..3218701 | + | 1320 | WP_254173965.1 | SPFH domain-containing protein | - |
| NMK36_RS13680 (NO713_02733) | 3218762..3219103 | - | 342 | WP_254173966.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NMK36_RS13685 (NO713_02734) | 3219097..3219339 | - | 243 | WP_072720577.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NMK36_RS13690 (NO713_02735) | 3219545..3220468 | - | 924 | WP_072720578.1 | ornithine carbamoyltransferase | - |
| NMK36_RS13695 (NO713_02736) | 3220635..3221660 | - | 1026 | WP_254173967.1 | tRNA dihydrouridine synthase DusB | - |
| NMK36_RS13700 (NO713_02737) | 3221757..3222044 | + | 288 | WP_139295122.1 | hypothetical protein | - |
| NMK36_RS13705 (NO713_02738) | 3222065..3223366 | - | 1302 | WP_254173968.1 | cyclic nucleotide-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12932.06 Da Isoelectric Point: 6.2191
>T289994 WP_254173966.1 NZ_LR882967:c3219103-3218762 [Planktothrix pseudagardhii]
MVNQSYIPDRGHIVKLNFNPTQGHEQKGLRPAFVISPYEYNVKNSLALFMPITAQVKGYPFEVSLPSELTTYGVILVDHI
KSLDYKVRLIQFIEIVPEDVIQEVQAKIEVLIF
MVNQSYIPDRGHIVKLNFNPTQGHEQKGLRPAFVISPYEYNVKNSLALFMPITAQVKGYPFEVSLPSELTTYGVILVDHI
KSLDYKVRLIQFIEIVPEDVIQEVQAKIEVLIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|