Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 2652571..2653142 Replicon chromosome
Accession NZ_LR882967
Organism Planktothrix pseudagardhii strain No.713

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NMK36_RS11240 Protein ID WP_254173733.1
Coordinates 2652801..2653142 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1LSZ9
Locus tag NMK36_RS11235 Protein ID WP_072721833.1
Coordinates 2652571..2652804 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK36_RS11215 (NO713_02233) 2648500..2651139 - 2640 WP_254173731.1 C39 family peptidase -
NMK36_RS11220 (NO713_02234) 2651251..2651688 - 438 WP_254173732.1 peroxiredoxin -
NMK36_RS11225 (NO713_02235) 2651863..2652075 + 213 WP_072721837.1 type II toxin-antitoxin system VapB family antitoxin -
NMK36_RS11230 (NO713_02236) 2652062..2652469 + 408 WP_072721835.1 PIN domain nuclease -
NMK36_RS11235 (NO713_02237) 2652571..2652804 + 234 WP_072721833.1 DUF433 domain-containing protein Antitoxin
NMK36_RS11240 (NO713_02238) 2652801..2653142 + 342 WP_254173733.1 DUF5615 family PIN-like protein Toxin
NMK36_RS11245 (NO713_02239) 2653150..2653416 - 267 WP_254173734.1 type II toxin-antitoxin system RelE/ParE family toxin -
NMK36_RS11250 (NO713_02240) 2653413..2653622 - 210 WP_072721829.1 hypothetical protein -
NMK36_RS11255 (NO713_02241) 2653910..2654434 + 525 WP_254173735.1 DUF262 domain-containing protein -
NMK36_RS11260 (NO713_02242) 2654783..2655016 + 234 WP_254173736.1 hypothetical protein -
NMK36_RS11265 (NO713_02243) 2655072..2655482 + 411 WP_072721824.1 hypothetical protein -
NMK36_RS11270 (NO713_02244) 2655511..2655993 - 483 WP_254173737.1 DUF4168 domain-containing protein -
NMK36_RS11275 (NO713_02245) 2656075..2656518 - 444 WP_254173738.1 DUF4168 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(11-66)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12785.66 Da        Isoelectric Point: 4.0834

>T289993 WP_254173733.1 NZ_LR882967:2652801-2653142 [Planktothrix pseudagardhii]
MKIWIDAQLPPTLANWLTETFGLEASALRDLELRDAQDLEIFEAARSENVVIMTKDSDFIDLVCRLGSPPQILWLTCGNV
TNRNLRQLLTATFPDALEQLRQGEMIVEITNTP

Download         Length: 342 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8591.02 Da        Isoelectric Point: 4.6320

>AT289993 WP_072721833.1 NZ_LR882967:2652571-2652804 [Planktothrix pseudagardhii]
MNLTTGLLNRITQTPGQCGGRPCIRGMRIRVTDILEMLAENVSITEILEDFPDLELADIQACLLFAARRTDFPRLTA

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1LSZ9

References