Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-DUF433 |
Location | 2652062..2652804 | Replicon | chromosome |
Accession | NZ_LR882967 | ||
Organism | Planktothrix pseudagardhii strain No.713 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1J1LQY8 |
Locus tag | NMK36_RS11230 | Protein ID | WP_072721835.1 |
Coordinates | 2652062..2652469 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1J1LSZ9 |
Locus tag | NMK36_RS11235 | Protein ID | WP_072721833.1 |
Coordinates | 2652571..2652804 (+) | Length | 78 a.a. |
Genomic Context
Location: 2651863..2652075 (213 bp)
Type: Others
Protein ID: WP_072721837.1
Type: Others
Protein ID: WP_072721837.1
Location: 2652062..2652469 (408 bp)
Type: Toxin
Protein ID: WP_072721835.1
Type: Toxin
Protein ID: WP_072721835.1
Location: 2652571..2652804 (234 bp)
Type: Antitoxin
Protein ID: WP_072721833.1
Type: Antitoxin
Protein ID: WP_072721833.1
Location: 2652801..2653142 (342 bp)
Type: Others
Protein ID: WP_254173733.1
Type: Others
Protein ID: WP_254173733.1
Location: 2653910..2654434 (525 bp)
Type: Others
Protein ID: WP_254173735.1
Type: Others
Protein ID: WP_254173735.1
Location: 2654783..2655016 (234 bp)
Type: Others
Protein ID: WP_254173736.1
Type: Others
Protein ID: WP_254173736.1
Location: 2655072..2655482 (411 bp)
Type: Others
Protein ID: WP_072721824.1
Type: Others
Protein ID: WP_072721824.1
Location: 2648500..2651139 (2640 bp)
Type: Others
Protein ID: WP_254173731.1
Type: Others
Protein ID: WP_254173731.1
Location: 2651251..2651688 (438 bp)
Type: Others
Protein ID: WP_254173732.1
Type: Others
Protein ID: WP_254173732.1
Location: 2653150..2653416 (267 bp)
Type: Others
Protein ID: WP_254173734.1
Type: Others
Protein ID: WP_254173734.1
Location: 2653413..2653622 (210 bp)
Type: Others
Protein ID: WP_072721829.1
Type: Others
Protein ID: WP_072721829.1
Location: 2655511..2655993 (483 bp)
Type: Others
Protein ID: WP_254173737.1
Type: Others
Protein ID: WP_254173737.1
Location: 2656075..2656518 (444 bp)
Type: Others
Protein ID: WP_254173738.1
Type: Others
Protein ID: WP_254173738.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK36_RS11215 (NO713_02233) | 2648500..2651139 | - | 2640 | WP_254173731.1 | C39 family peptidase | - |
NMK36_RS11220 (NO713_02234) | 2651251..2651688 | - | 438 | WP_254173732.1 | peroxiredoxin | - |
NMK36_RS11225 (NO713_02235) | 2651863..2652075 | + | 213 | WP_072721837.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NMK36_RS11230 (NO713_02236) | 2652062..2652469 | + | 408 | WP_072721835.1 | PIN domain nuclease | Toxin |
NMK36_RS11235 (NO713_02237) | 2652571..2652804 | + | 234 | WP_072721833.1 | DUF433 domain-containing protein | Antitoxin |
NMK36_RS11240 (NO713_02238) | 2652801..2653142 | + | 342 | WP_254173733.1 | DUF5615 family PIN-like protein | - |
NMK36_RS11245 (NO713_02239) | 2653150..2653416 | - | 267 | WP_254173734.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NMK36_RS11250 (NO713_02240) | 2653413..2653622 | - | 210 | WP_072721829.1 | hypothetical protein | - |
NMK36_RS11255 (NO713_02241) | 2653910..2654434 | + | 525 | WP_254173735.1 | DUF262 domain-containing protein | - |
NMK36_RS11260 (NO713_02242) | 2654783..2655016 | + | 234 | WP_254173736.1 | hypothetical protein | - |
NMK36_RS11265 (NO713_02243) | 2655072..2655482 | + | 411 | WP_072721824.1 | hypothetical protein | - |
NMK36_RS11270 (NO713_02244) | 2655511..2655993 | - | 483 | WP_254173737.1 | DUF4168 domain-containing protein | - |
NMK36_RS11275 (NO713_02245) | 2656075..2656518 | - | 444 | WP_254173738.1 | DUF4168 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15892.06 Da Isoelectric Point: 5.7402
>T289992 WP_072721835.1 NZ_LR882967:2652062-2652469 [Planktothrix pseudagardhii]
MFLIDTSVWISVFRDRTGAVRQSLEAIINNKSIFLSRFTQMELLQGCRDDREWTLLETYLQDQDYIEATADTWVAAARIY
YDLQRQGLTVRSSIDCCIAQLAIKHQLTLVHNDRDFETIQRVRSLNCLRFRPENN
MFLIDTSVWISVFRDRTGAVRQSLEAIINNKSIFLSRFTQMELLQGCRDDREWTLLETYLQDQDYIEATADTWVAAARIY
YDLQRQGLTVRSSIDCCIAQLAIKHQLTLVHNDRDFETIQRVRSLNCLRFRPENN
Download Length: 408 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1LQY8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1LSZ9 |