Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2273217..2273830 | Replicon | chromosome |
Accession | NZ_LR882967 | ||
Organism | Planktothrix pseudagardhii strain No.713 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7Z9BN42 |
Locus tag | NMK36_RS09550 | Protein ID | WP_072722242.1 |
Coordinates | 2273217..2273603 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A7Z9BU65 |
Locus tag | NMK36_RS09555 | Protein ID | WP_072722241.1 |
Coordinates | 2273600..2273830 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK36_RS09540 (NO713_01905) | 2268616..2269695 | + | 1080 | WP_072722243.1 | fructose-bisphosphate aldolase class II | - |
NMK36_RS09545 (NO713_01906) | 2269932..2273015 | + | 3084 | WP_254173612.1 | N-6 DNA methylase | - |
NMK36_RS09550 (NO713_01907) | 2273217..2273603 | - | 387 | WP_072722242.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NMK36_RS09555 (NO713_01908) | 2273600..2273830 | - | 231 | WP_072722241.1 | DUF2281 domain-containing protein | Antitoxin |
NMK36_RS09560 (NO713_01909) | 2274012..2275217 | + | 1206 | WP_072722240.1 | sodium/glutamate symporter | - |
NMK36_RS09565 (NO713_01910) | 2275264..2275758 | - | 495 | WP_072722239.1 | hypothetical protein | - |
NMK36_RS09570 (NO713_01911) | 2276063..2277496 | + | 1434 | WP_254173613.1 | circularly permuted type 2 ATP-grasp protein | - |
NMK36_RS09575 (NO713_01912) | 2277599..2278588 | + | 990 | WP_072722237.1 | alpha-E domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14991.42 Da Isoelectric Point: 4.6643
>T289991 WP_072722242.1 NZ_LR882967:c2273603-2273217 [Planktothrix pseudagardhii]
MNSFLLDTHTFIWLSENDPNLPDSLREMIDIADHVYLSIASLWEIAIKLNLGKLSLQQSYKTIEDKLENSDILLLPIMFI
DTLQICNLPLHHRDPFDRMLIAQAINRSLILISRDIKFDAYPIQRLWD
MNSFLLDTHTFIWLSENDPNLPDSLREMIDIADHVYLSIASLWEIAIKLNLGKLSLQQSYKTIEDKLENSDILLLPIMFI
DTLQICNLPLHHRDPFDRMLIAQAINRSLILISRDIKFDAYPIQRLWD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z9BN42 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z9BU65 |