Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TacT2-ataR/DUF1778(antitoxin) |
Location | 1664559..1665403 | Replicon | chromosome |
Accession | NZ_LR882967 | ||
Organism | Planktothrix pseudagardhii strain No.713 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NMK36_RS07100 | Protein ID | WP_254173409.1 |
Coordinates | 1664882..1665403 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | NMK36_RS07095 | Protein ID | WP_254173408.1 |
Coordinates | 1664559..1664891 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK36_RS07080 (NO713_01408) | 1660843..1661874 | + | 1032 | WP_254173406.1 | M48 family metalloprotease | - |
NMK36_RS07085 (NO713_01410) | 1662032..1664098 | - | 2067 | WP_254173407.1 | AAA family ATPase | - |
NMK36_RS07090 (NO713_01411) | 1664095..1664334 | - | 240 | WP_193867872.1 | hypothetical protein | - |
NMK36_RS07095 (NO713_01412) | 1664559..1664891 | + | 333 | WP_254173408.1 | DUF1778 domain-containing protein | Antitoxin |
NMK36_RS07100 (NO713_01413) | 1664882..1665403 | + | 522 | WP_254173409.1 | GNAT family N-acetyltransferase | Toxin |
NMK36_RS07105 (NO713_01414) | 1665417..1666787 | - | 1371 | WP_254173410.1 | DNA phosphorothioation system restriction enzyme | - |
NMK36_RS07110 (NO713_01415) | 1666932..1667360 | - | 429 | WP_072717069.1 | hypothetical protein | - |
NMK36_RS07115 (NO713_01416) | 1667499..1667858 | - | 360 | WP_072717068.1 | hypothetical protein | - |
NMK36_RS07125 (NO713_01417) | 1668145..1669314 | + | 1170 | WP_245824150.1 | DUF3326 domain-containing protein | - |
NMK36_RS07130 (NO713_01418) | 1669396..1669923 | + | 528 | WP_083579860.1 | CPBP family intramembrane metalloprotease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19104.05 Da Isoelectric Point: 7.8466
>T289989 WP_254173409.1 NZ_LR882967:1664882-1665403 [Planktothrix pseudagardhii]
VGLDRDRDKLSPPEKLNPSHQIDNFDSGNSQLDDWLKRRAWKNELEGASRTYVLCVGEVVVAYYCLANGAVARNIATGGV
RRNMPDPIPVMIIGRLAVDRQWQNQGIGRAMLRDAILRTLQAAEIAGIRAILVHAISEEAKLFYQKYGFAALESDPMILM
VKVSDAIISLGLG
VGLDRDRDKLSPPEKLNPSHQIDNFDSGNSQLDDWLKRRAWKNELEGASRTYVLCVGEVVVAYYCLANGAVARNIATGGV
RRNMPDPIPVMIIGRLAVDRQWQNQGIGRAMLRDAILRTLQAAEIAGIRAILVHAISEEAKLFYQKYGFAALESDPMILM
VKVSDAIISLGLG
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|