Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 4546917..4547560 Replicon chromosome
Accession NZ_LR882963
Organism Planktothrix agardhii strain No.66

Toxin (Protein)


Gene name vapC Uniprot ID A0A073CFP1
Locus tag NMG84_RS20815 Protein ID WP_042153936.1
Coordinates 4547162..4547560 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NMG84_RS20810 Protein ID WP_042157396.1
Coordinates 4546917..4547165 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG84_RS20780 (PANO66_04152) 4542460..4543377 + 918 WP_042157400.1 NAD(+) kinase -
NMG84_RS20785 (PANO66_04153) 4543492..4544187 + 696 WP_026785406.1 response regulator transcription factor -
NMG84_RS20790 (PANO66_04154) 4544411..4544974 + 564 WP_227350526.1 DUF192 domain-containing protein -
NMG84_RS20795 (PANO66_04155) 4545631..4545846 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMG84_RS20800 4545989..4546144 - 156 WP_167541238.1 hypothetical protein -
NMG84_RS20805 (PANO66_04158) 4546415..4546858 + 444 WP_042153938.1 type II toxin-antitoxin system VapC family toxin -
NMG84_RS20810 (PANO66_04159) 4546917..4547165 + 249 WP_042157396.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG84_RS20815 (PANO66_04160) 4547162..4547560 + 399 WP_042153936.1 type II toxin-antitoxin system VapC family toxin Toxin
NMG84_RS20820 (PANO66_04161) 4547768..4547998 + 231 WP_227381613.1 DUF433 domain-containing protein -
NMG84_RS20825 (PANO66_04162) 4548081..4548233 - 153 WP_254032666.1 PIN domain-containing protein -
NMG84_RS20830 (PANO66_04163) 4548235..4548456 - 222 WP_042153932.1 DUF2281 domain-containing protein -
NMG84_RS20835 (PANO66_04164) 4548711..4549454 - 744 WP_254032667.1 hypothetical protein -
NMG84_RS20840 (PANO66_04165) 4549722..4550291 + 570 WP_254032668.1 hypothetical protein -
NMG84_RS20845 (PANO66_04166) 4550332..4551225 - 894 WP_042153928.1 acetylglutamate kinase -
NMG84_RS20850 (PANO66_04167) 4551305..4551844 - 540 WP_042153926.1 rod shape-determining protein MreD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(8-42)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15297.68 Da        Isoelectric Point: 4.6761

>T289987 WP_042153936.1 NZ_LR882963:4547162-4547560 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEITA
PHALRSSALPLHHRDPFDRMLIAQAQIEDMTLVSADSMFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9175.37 Da        Isoelectric Point: 4.2702

>AT289987 WP_042157396.1 NZ_LR882963:4546917-4547165 [Planktothrix agardhii]
IQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAFEGN
EQ

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A073CFP1

Antitoxin

Source ID Structure

References