Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 2013924..2014486 Replicon chromosome
Accession NZ_LR882963
Organism Planktothrix agardhii strain No.66

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMG84_RS08980 Protein ID WP_026786450.1
Coordinates 2014151..2014486 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMG84_RS08975 Protein ID WP_026786451.1
Coordinates 2013924..2014154 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG84_RS08945 (PANO66_01785) 2009130..2009711 + 582 WP_254032275.1 class I SAM-dependent methyltransferase -
NMG84_RS08950 (PANO66_01786) 2009786..2011888 - 2103 WP_254032276.1 tetratricopeptide repeat protein -
NMG84_RS08955 (PANO66_01787) 2011866..2012069 - 204 WP_026797898.1 hypothetical protein -
NMG84_RS08960 (PANO66_01788) 2012528..2012827 + 300 WP_026797899.1 hypothetical protein -
NMG84_RS08965 (PANO66_01789) 2012981..2013382 + 402 WP_227366197.1 type II toxin-antitoxin system VapC family toxin -
NMG84_RS08970 (PANO66_01790) 2013665..2013922 + 258 WP_254032277.1 type II toxin-antitoxin system HicB family antitoxin -
NMG84_RS08975 (PANO66_01791) 2013924..2014154 + 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMG84_RS08980 (PANO66_01792) 2014151..2014486 + 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMG84_RS08985 (PANO66_01793) 2014701..2014997 + 297 WP_254032278.1 hypothetical protein -
NMG84_RS08990 (PANO66_01794) 2014954..2015473 - 520 Protein_1770 hypothetical protein -
NMG84_RS08995 (PANO66_01795) 2015689..2016060 + 372 WP_254032704.1 Uma2 family endonuclease -
NMG84_RS09000 (PANO66_01796) 2016142..2017155 - 1014 WP_042158409.1 IS701-like element ISPlag1 family transposase -
NMG84_RS09005 (PANO66_01797) 2017375..2017557 + 183 WP_254032279.1 hypothetical protein -
NMG84_RS09010 (PANO66_01798) 2017903..2018352 + 450 WP_042152432.1 DUF29 domain-containing protein -
NMG84_RS09015 (PANO66_01799) 2018349..2018720 + 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMG84_RS09020 (PANO66_01800) 2018741..2019169 + 429 WP_227366191.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289984 WP_026786450.1 NZ_LR882963:2014151-2014486 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289984 WP_026786451.1 NZ_LR882963:2013924-2014154 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References