Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 2013924..2014486 | Replicon | chromosome |
| Accession | NZ_LR882963 | ||
| Organism | Planktothrix agardhii strain No.66 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1J1JI02 |
| Locus tag | NMG84_RS08980 | Protein ID | WP_026786450.1 |
| Coordinates | 2014151..2014486 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1J1JJG5 |
| Locus tag | NMG84_RS08975 | Protein ID | WP_026786451.1 |
| Coordinates | 2013924..2014154 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMG84_RS08945 (PANO66_01785) | 2009130..2009711 | + | 582 | WP_254032275.1 | class I SAM-dependent methyltransferase | - |
| NMG84_RS08950 (PANO66_01786) | 2009786..2011888 | - | 2103 | WP_254032276.1 | tetratricopeptide repeat protein | - |
| NMG84_RS08955 (PANO66_01787) | 2011866..2012069 | - | 204 | WP_026797898.1 | hypothetical protein | - |
| NMG84_RS08960 (PANO66_01788) | 2012528..2012827 | + | 300 | WP_026797899.1 | hypothetical protein | - |
| NMG84_RS08965 (PANO66_01789) | 2012981..2013382 | + | 402 | WP_227366197.1 | type II toxin-antitoxin system VapC family toxin | - |
| NMG84_RS08970 (PANO66_01790) | 2013665..2013922 | + | 258 | WP_254032277.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NMG84_RS08975 (PANO66_01791) | 2013924..2014154 | + | 231 | WP_026786451.1 | DUF433 domain-containing protein | Antitoxin |
| NMG84_RS08980 (PANO66_01792) | 2014151..2014486 | + | 336 | WP_026786450.1 | DUF5615 family PIN-like protein | Toxin |
| NMG84_RS08985 (PANO66_01793) | 2014701..2014997 | + | 297 | WP_254032278.1 | hypothetical protein | - |
| NMG84_RS08990 (PANO66_01794) | 2014954..2015473 | - | 520 | Protein_1770 | hypothetical protein | - |
| NMG84_RS08995 (PANO66_01795) | 2015689..2016060 | + | 372 | WP_254032704.1 | Uma2 family endonuclease | - |
| NMG84_RS09000 (PANO66_01796) | 2016142..2017155 | - | 1014 | WP_042158409.1 | IS701-like element ISPlag1 family transposase | - |
| NMG84_RS09005 (PANO66_01797) | 2017375..2017557 | + | 183 | WP_254032279.1 | hypothetical protein | - |
| NMG84_RS09010 (PANO66_01798) | 2017903..2018352 | + | 450 | WP_042152432.1 | DUF29 domain-containing protein | - |
| NMG84_RS09015 (PANO66_01799) | 2018349..2018720 | + | 372 | WP_026794176.1 | nucleotidyltransferase domain-containing protein | - |
| NMG84_RS09020 (PANO66_01800) | 2018741..2019169 | + | 429 | WP_227366191.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12268.99 Da Isoelectric Point: 3.9823
>T289984 WP_026786450.1 NZ_LR882963:2014151-2014486 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J1JI02 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J1JJG5 |