Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3638806..3639462 | Replicon | chromosome |
Accession | NZ_LR882952 | ||
Organism | Planktothrix agardhii strain No.976 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A4P5ZG20 |
Locus tag | NMG88_RS16905 | Protein ID | WP_026798539.1 |
Coordinates | 3639064..3639462 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1J1J9N3 |
Locus tag | NMG88_RS16900 | Protein ID | WP_026795934.1 |
Coordinates | 3638806..3639051 (+) | Length | 82 a.a. |
Genomic Context
Location: 3634479..3635174 (696 bp)
Type: Others
Protein ID: WP_026785406.1
Type: Others
Protein ID: WP_026785406.1
Location: 3635347..3635910 (564 bp)
Type: Others
Protein ID: WP_227350526.1
Type: Others
Protein ID: WP_227350526.1
Location: 3636567..3636782 (216 bp)
Type: Others
Protein ID: WP_036831945.1
Type: Others
Protein ID: WP_036831945.1
Location: 3637079..3637354 (276 bp)
Type: Others
Protein ID: WP_235751408.1
Type: Others
Protein ID: WP_235751408.1
Location: 3637351..3637671 (321 bp)
Type: Others
Protein ID: WP_235751407.1
Type: Others
Protein ID: WP_235751407.1
Location: 3638806..3639051 (246 bp)
Type: Antitoxin
Protein ID: WP_026795934.1
Type: Antitoxin
Protein ID: WP_026795934.1
Location: 3639064..3639462 (399 bp)
Type: Toxin
Protein ID: WP_026798539.1
Type: Toxin
Protein ID: WP_026798539.1
Location: 3641284..3642657 (1374 bp)
Type: Others
Protein ID: WP_254035641.1
Type: Others
Protein ID: WP_254035641.1
Location: 3636925..3637080 (156 bp)
Type: Others
Protein ID: WP_167541238.1
Type: Others
Protein ID: WP_167541238.1
Location: 3637678..3637902 (225 bp)
Type: Others
Protein ID: WP_237747547.1
Type: Others
Protein ID: WP_237747547.1
Location: 3637969..3638373 (405 bp)
Type: Others
Protein ID: WP_026785412.1
Type: Others
Protein ID: WP_026785412.1
Location: 3638376..3638624 (249 bp)
Type: Others
Protein ID: WP_036831938.1
Type: Others
Protein ID: WP_036831938.1
Location: 3639619..3640002 (384 bp)
Type: Others
Protein ID: WP_026785416.1
Type: Others
Protein ID: WP_026785416.1
Location: 3639995..3640237 (243 bp)
Type: Others
Protein ID: WP_235751405.1
Type: Others
Protein ID: WP_235751405.1
Location: 3640477..3641070 (594 bp)
Type: Others
Protein ID: WP_027255350.1
Type: Others
Protein ID: WP_027255350.1
Location: 3642688..3643074 (387 bp)
Type: Others
Protein ID: WP_227365720.1
Type: Others
Protein ID: WP_227365720.1
Location: 3643076..3643318 (243 bp)
Type: Others
Protein ID: WP_227365722.1
Type: Others
Protein ID: WP_227365722.1
Location: 3643549..3644442 (894 bp)
Type: Others
Protein ID: WP_042153928.1
Type: Others
Protein ID: WP_042153928.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG88_RS16855 (NO976_03374) | 3634479..3635174 | + | 696 | WP_026785406.1 | response regulator transcription factor | - |
NMG88_RS16860 (NO976_03375) | 3635347..3635910 | + | 564 | WP_227350526.1 | DUF192 domain-containing protein | - |
NMG88_RS16865 (NO976_03376) | 3636567..3636782 | + | 216 | WP_036831945.1 | DUF2949 domain-containing protein | - |
NMG88_RS16870 | 3636925..3637080 | - | 156 | WP_167541238.1 | hypothetical protein | - |
NMG88_RS16875 (NO976_03378) | 3637079..3637354 | + | 276 | WP_235751408.1 | hypothetical protein | - |
NMG88_RS16880 (NO976_03379) | 3637351..3637671 | + | 321 | WP_235751407.1 | type II toxin-antitoxin system VapC family toxin | - |
NMG88_RS16885 | 3637678..3637902 | - | 225 | WP_237747547.1 | hypothetical protein | - |
NMG88_RS16890 (NO976_03381) | 3637969..3638373 | - | 405 | WP_026785412.1 | PIN domain-containing protein | - |
NMG88_RS16895 (NO976_03382) | 3638376..3638624 | - | 249 | WP_036831938.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
NMG88_RS16900 (NO976_03383) | 3638806..3639051 | + | 246 | WP_026795934.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NMG88_RS16905 (NO976_03384) | 3639064..3639462 | + | 399 | WP_026798539.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NMG88_RS16910 (NO976_03385) | 3639619..3640002 | - | 384 | WP_026785416.1 | type II toxin-antitoxin system VapC family toxin | - |
NMG88_RS16915 (NO976_03386) | 3639995..3640237 | - | 243 | WP_235751405.1 | hypothetical protein | - |
NMG88_RS16920 (NO976_03387) | 3640477..3641070 | - | 594 | WP_027255350.1 | hypothetical protein | - |
NMG88_RS16925 (NO976_03388) | 3641284..3642657 | + | 1374 | WP_254035641.1 | NB-ARC domain-containing protein | - |
NMG88_RS16930 (NO976_03389) | 3642688..3643074 | - | 387 | WP_227365720.1 | type II toxin-antitoxin system VapC family toxin | - |
NMG88_RS16935 (NO976_03390) | 3643076..3643318 | - | 243 | WP_227365722.1 | hypothetical protein | - |
NMG88_RS16940 (NO976_03391) | 3643549..3644442 | - | 894 | WP_042153928.1 | acetylglutamate kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15305.73 Da Isoelectric Point: 5.1406
>T289983 WP_026798539.1 NZ_LR882952:3639064-3639462 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEIKA
PHALRSSALPLHHRDPFDRMLIAQAQIENMTLVSADSIFKQYSDISVLWAAN
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEIKA
PHALRSSALPLHHRDPFDRMLIAQAQIENMTLVSADSIFKQYSDISVLWAAN
Download Length: 399 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P5ZG20 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1J9N3 |