Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 3638806..3639462 Replicon chromosome
Accession NZ_LR882952
Organism Planktothrix agardhii strain No.976

Toxin (Protein)


Gene name vapC Uniprot ID A0A4P5ZG20
Locus tag NMG88_RS16905 Protein ID WP_026798539.1
Coordinates 3639064..3639462 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1J9N3
Locus tag NMG88_RS16900 Protein ID WP_026795934.1
Coordinates 3638806..3639051 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG88_RS16855 (NO976_03374) 3634479..3635174 + 696 WP_026785406.1 response regulator transcription factor -
NMG88_RS16860 (NO976_03375) 3635347..3635910 + 564 WP_227350526.1 DUF192 domain-containing protein -
NMG88_RS16865 (NO976_03376) 3636567..3636782 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMG88_RS16870 3636925..3637080 - 156 WP_167541238.1 hypothetical protein -
NMG88_RS16875 (NO976_03378) 3637079..3637354 + 276 WP_235751408.1 hypothetical protein -
NMG88_RS16880 (NO976_03379) 3637351..3637671 + 321 WP_235751407.1 type II toxin-antitoxin system VapC family toxin -
NMG88_RS16885 3637678..3637902 - 225 WP_237747547.1 hypothetical protein -
NMG88_RS16890 (NO976_03381) 3637969..3638373 - 405 WP_026785412.1 PIN domain-containing protein -
NMG88_RS16895 (NO976_03382) 3638376..3638624 - 249 WP_036831938.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NMG88_RS16900 (NO976_03383) 3638806..3639051 + 246 WP_026795934.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG88_RS16905 (NO976_03384) 3639064..3639462 + 399 WP_026798539.1 type II toxin-antitoxin system VapC family toxin Toxin
NMG88_RS16910 (NO976_03385) 3639619..3640002 - 384 WP_026785416.1 type II toxin-antitoxin system VapC family toxin -
NMG88_RS16915 (NO976_03386) 3639995..3640237 - 243 WP_235751405.1 hypothetical protein -
NMG88_RS16920 (NO976_03387) 3640477..3641070 - 594 WP_027255350.1 hypothetical protein -
NMG88_RS16925 (NO976_03388) 3641284..3642657 + 1374 WP_254035641.1 NB-ARC domain-containing protein -
NMG88_RS16930 (NO976_03389) 3642688..3643074 - 387 WP_227365720.1 type II toxin-antitoxin system VapC family toxin -
NMG88_RS16935 (NO976_03390) 3643076..3643318 - 243 WP_227365722.1 hypothetical protein -
NMG88_RS16940 (NO976_03391) 3643549..3644442 - 894 WP_042153928.1 acetylglutamate kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15305.73 Da        Isoelectric Point: 5.1406

>T289983 WP_026798539.1 NZ_LR882952:3639064-3639462 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEIKA
PHALRSSALPLHHRDPFDRMLIAQAQIENMTLVSADSIFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9077.41 Da        Isoelectric Point: 4.5358

>AT289983 WP_026795934.1 NZ_LR882952:3638806-3639051 [Planktothrix agardhii]
MAKLQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAF
E

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P5ZG20

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1J9N3

References