Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 1886697..1887174 Replicon chromosome
Accession NZ_LR882952
Organism Planktothrix agardhii strain No.976

Toxin (Protein)


Gene name - Uniprot ID A0A1J1JEC9
Locus tag NMG88_RS08755 Protein ID WP_042155864.1
Coordinates 1886902..1887174 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A1J1JHM1
Locus tag NMG88_RS08750 Protein ID WP_042155865.1
Coordinates 1886697..1886921 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG88_RS08710 (NO976_01752) 1881728..1882204 - 477 WP_042155870.1 R3H domain-containing nucleic acid-binding protein -
NMG88_RS08715 (NO976_01753) 1882207..1883364 - 1158 WP_042155869.1 membrane protein insertase YidC -
NMG88_RS08720 (NO976_01754) 1883510..1883902 - 393 WP_227364941.1 PH domain-containing protein -
NMG88_RS08725 (NO976_01755) 1883874..1884278 - 405 WP_042155868.1 ribonuclease P protein component -
NMG88_RS08730 (NO976_01756) 1884388..1884525 - 138 WP_071783091.1 50S ribosomal protein L34 -
NMG88_RS08735 (NO976_01757) 1884642..1885151 - 510 WP_026797999.1 DUF2808 domain-containing protein -
NMG88_RS08740 (NO976_01758) 1885299..1885943 - 645 WP_042155867.1 Uma2 family endonuclease -
NMG88_RS08745 (NO976_01759) 1886134..1886475 - 342 WP_235766172.1 DUF433 domain-containing protein -
NMG88_RS08750 (NO976_01761) 1886697..1886921 - 225 WP_042155865.1 CopG family antitoxin Antitoxin
NMG88_RS08755 (NO976_01762) 1886902..1887174 - 273 WP_042155864.1 BrnT family toxin Toxin
NMG88_RS08760 (NO976_01764) 1887526..1888056 - 531 WP_254035323.1 helix-turn-helix domain-containing protein -
NMG88_RS08765 (NO976_01765) 1888228..1889073 + 846 WP_254035324.1 calcium-binding protein -
NMG88_RS08770 (NO976_01766) 1889251..1889760 + 510 WP_254035325.1 hypothetical protein -
NMG88_RS08775 1889912..1890130 - 219 Protein_1732 IS701 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin

CopG antitoxin

(3-68)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10918.26 Da        Isoelectric Point: 7.2018

>T289981 WP_042155864.1 NZ_LR882952:c1887174-1886902 [Planktothrix agardhii]
MYSFEYDDNKSRTNQQKHGIDFIEAQQLWQDDDLLEIQATSETESRFLAIGKLKQKHWTAVITYRLENIRIISVRRSRPN
EVIWYESRRI

Download         Length: 273 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8689.84 Da        Isoelectric Point: 4.4633

>AT289981 WP_042155865.1 NZ_LR882952:c1886921-1886697 [Planktothrix agardhii]
MKAEEFDAKFDTGEDLTEFMDFSTARRPNREKQKIELNLPLWMIRQLEAEAQKQGISPQTFLENYLAENLAPVR

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JEC9

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JHM1

References