Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 1124030..1124592 Replicon chromosome
Accession NZ_LR882952
Organism Planktothrix agardhii strain No.976

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMG88_RS05235 Protein ID WP_026786450.1
Coordinates 1124257..1124592 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMG88_RS05230 Protein ID WP_026786451.1
Coordinates 1124030..1124260 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG88_RS05200 (NO976_01041) 1120206..1120775 + 570 WP_202807045.1 GNAT family protein -
NMG88_RS05205 (NO976_01042) 1120765..1121688 + 924 WP_254035182.1 hypothetical protein -
NMG88_RS05210 (NO976_01043) 1121862..1122119 + 258 WP_254035183.1 N-acetylneuraminate synthase family protein -
NMG88_RS05215 (NO976_01044) 1122172..1122498 + 327 WP_254035184.1 hypothetical protein -
NMG88_RS05220 (NO976_01045) 1122463..1123385 - 923 Protein_1031 IS4 family transposase -
NMG88_RS05225 (NO976_01047) 1123888..1124028 + 141 WP_227357797.1 hypothetical protein -
NMG88_RS05230 (NO976_01048) 1124030..1124260 + 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMG88_RS05235 (NO976_01049) 1124257..1124592 + 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMG88_RS05240 (NO976_01050) 1124807..1125535 + 729 WP_235751126.1 Uma2 family endonuclease -
NMG88_RS05245 (NO976_01051) 1125881..1126330 + 450 WP_042152432.1 DUF29 domain-containing protein -
NMG88_RS05250 (NO976_01052) 1126327..1126698 + 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMG88_RS05255 (NO976_01053) 1126719..1127147 + 429 WP_227366191.1 hypothetical protein -
NMG88_RS05260 (NO976_01054) 1127190..1127834 - 645 WP_026786446.1 Uma2 family endonuclease -
NMG88_RS05265 (NO976_01055) 1127922..1129199 + 1278 WP_254035185.1 FkbM family methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1122463..1123080 617


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289979 WP_026786450.1 NZ_LR882952:1124257-1124592 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289979 WP_026786451.1 NZ_LR882952:1124030-1124260 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References