Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 4545268..4545924 Replicon chromosome
Accession NZ_LR882950
Organism Planktothrix agardhii strain PCC7805

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JAG8
Locus tag NMG85_RS20735 Protein ID WP_026785415.1
Coordinates 4545526..4545924 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1J9N3
Locus tag NMG85_RS20730 Protein ID WP_026795934.1
Coordinates 4545268..4545513 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG85_RS20685 (PCC7805_04151) 4540890..4541585 + 696 WP_026785406.1 response regulator transcription factor -
NMG85_RS20690 (PCC7805_04152) 4541758..4542372 + 615 WP_233428074.1 DUF192 domain-containing protein -
NMG85_RS20695 (PCC7805_04153) 4543029..4543244 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMG85_RS20700 4543387..4543542 - 156 WP_167541238.1 hypothetical protein -
NMG85_RS20705 (PCC7805_04155) 4543541..4543816 + 276 WP_235751408.1 hypothetical protein -
NMG85_RS20710 (PCC7805_04156) 4543813..4544133 + 321 WP_235751407.1 type II toxin-antitoxin system VapC family toxin -
NMG85_RS20715 4544140..4544364 - 225 WP_237747547.1 hypothetical protein -
NMG85_RS20720 (PCC7805_04158) 4544431..4544835 - 405 WP_026785412.1 PIN domain-containing protein -
NMG85_RS20725 (PCC7805_04159) 4544838..4545086 - 249 WP_036831938.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NMG85_RS20730 (PCC7805_04160) 4545268..4545513 + 246 WP_026795934.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG85_RS20735 (PCC7805_04161) 4545526..4545924 + 399 WP_026785415.1 type II toxin-antitoxin system VapC family toxin Toxin
NMG85_RS20740 (PCC7805_04162) 4546081..4546464 - 384 WP_026785416.1 type II toxin-antitoxin system VapC family toxin -
NMG85_RS20745 (PCC7805_04163) 4546457..4546699 - 243 WP_235751405.1 hypothetical protein -
NMG85_RS20750 4546754..4546897 + 144 WP_235751404.1 hypothetical protein -
NMG85_RS20755 4547022..4547255 - 234 WP_235751403.1 HNH endonuclease -
NMG85_RS20760 (PCC7805_04164) 4547448..4547699 - 252 WP_235751402.1 hypothetical protein -
NMG85_RS20765 (PCC7805_04165) 4547942..4549327 + 1386 WP_235765748.1 NB-ARC domain-containing protein -
NMG85_RS20770 (PCC7805_04166) 4549358..4549744 - 387 WP_227365720.1 type II toxin-antitoxin system VapC family toxin -
NMG85_RS20775 (PCC7805_04167) 4549746..4549988 - 243 WP_227365722.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15264.63 Da        Isoelectric Point: 4.8382

>T289978 WP_026785415.1 NZ_LR882950:4545526-4545924 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEITA
PHALRSSALPLHHRDPFDRMLIAQAQIDNMTLVSADSIFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9077.41 Da        Isoelectric Point: 4.5358

>AT289978 WP_026795934.1 NZ_LR882950:4545268-4545513 [Planktothrix agardhii]
MAKLQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAF
E

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JAG8

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1J9N3

References