Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 1355590..1356152 Replicon chromosome
Accession NZ_LR882950
Organism Planktothrix agardhii strain PCC7805

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMG85_RS05895 Protein ID WP_026786450.1
Coordinates 1355590..1355925 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMG85_RS05900 Protein ID WP_026786451.1
Coordinates 1355922..1356152 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG85_RS05865 (PCC7805_01180) 1351041..1351685 + 645 WP_227350210.1 Uma2 family endonuclease -
NMG85_RS05870 (PCC7805_01181) 1351728..1352018 - 291 WP_052338730.1 hypothetical protein -
NMG85_RS05875 (PCC7805_01182) 1352098..1353270 - 1173 WP_254034382.1 transposase -
NMG85_RS05880 (PCC7805_01184) 1353484..1353855 - 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMG85_RS05885 (PCC7805_01185) 1353852..1354301 - 450 WP_042152432.1 DUF29 domain-containing protein -
NMG85_RS05890 (PCC7805_01186) 1354647..1355375 - 729 WP_235751126.1 Uma2 family endonuclease -
NMG85_RS05895 (PCC7805_01187) 1355590..1355925 - 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMG85_RS05900 (PCC7805_01188) 1355922..1356152 - 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMG85_RS05905 (PCC7805_01189) 1356154..1356294 - 141 WP_227366195.1 hypothetical protein -
NMG85_RS05910 (PCC7805_01190) 1356695..1357096 - 402 WP_227366197.1 type II toxin-antitoxin system VapC family toxin -
NMG85_RS05915 (PCC7805_01191) 1357250..1357549 - 300 WP_026797899.1 hypothetical protein -
NMG85_RS05920 (PCC7805_01192) 1358011..1358217 + 207 WP_141295995.1 hypothetical protein -
NMG85_RS05925 (PCC7805_01193) 1358261..1358482 + 222 WP_026786454.1 type II toxin-antitoxin system HicB family antitoxin -
NMG85_RS05930 (PCC7805_01194) 1358536..1360152 + 1617 WP_254034383.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1352098..1353270 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289974 WP_026786450.1 NZ_LR882950:c1355925-1355590 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289974 WP_026786451.1 NZ_LR882950:c1356152-1355922 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References