Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 1355590..1356152 | Replicon | chromosome |
Accession | NZ_LR882950 | ||
Organism | Planktothrix agardhii strain PCC7805 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1J1JI02 |
Locus tag | NMG85_RS05895 | Protein ID | WP_026786450.1 |
Coordinates | 1355590..1355925 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1J1JJG5 |
Locus tag | NMG85_RS05900 | Protein ID | WP_026786451.1 |
Coordinates | 1355922..1356152 (-) | Length | 77 a.a. |
Genomic Context
Location: 1351041..1351685 (645 bp)
Type: Others
Protein ID: WP_227350210.1
Type: Others
Protein ID: WP_227350210.1
Location: 1358011..1358217 (207 bp)
Type: Others
Protein ID: WP_141295995.1
Type: Others
Protein ID: WP_141295995.1
Location: 1358261..1358482 (222 bp)
Type: Others
Protein ID: WP_026786454.1
Type: Others
Protein ID: WP_026786454.1
Location: 1358536..1360152 (1617 bp)
Type: Others
Protein ID: WP_254034383.1
Type: Others
Protein ID: WP_254034383.1
Location: 1351728..1352018 (291 bp)
Type: Others
Protein ID: WP_052338730.1
Type: Others
Protein ID: WP_052338730.1
Location: 1352098..1353270 (1173 bp)
Type: Others
Protein ID: WP_254034382.1
Type: Others
Protein ID: WP_254034382.1
Location: 1353484..1353855 (372 bp)
Type: Others
Protein ID: WP_026794176.1
Type: Others
Protein ID: WP_026794176.1
Location: 1353852..1354301 (450 bp)
Type: Others
Protein ID: WP_042152432.1
Type: Others
Protein ID: WP_042152432.1
Location: 1354647..1355375 (729 bp)
Type: Others
Protein ID: WP_235751126.1
Type: Others
Protein ID: WP_235751126.1
Location: 1355590..1355925 (336 bp)
Type: Toxin
Protein ID: WP_026786450.1
Type: Toxin
Protein ID: WP_026786450.1
Location: 1355922..1356152 (231 bp)
Type: Antitoxin
Protein ID: WP_026786451.1
Type: Antitoxin
Protein ID: WP_026786451.1
Location: 1356154..1356294 (141 bp)
Type: Others
Protein ID: WP_227366195.1
Type: Others
Protein ID: WP_227366195.1
Location: 1356695..1357096 (402 bp)
Type: Others
Protein ID: WP_227366197.1
Type: Others
Protein ID: WP_227366197.1
Location: 1357250..1357549 (300 bp)
Type: Others
Protein ID: WP_026797899.1
Type: Others
Protein ID: WP_026797899.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMG85_RS05865 (PCC7805_01180) | 1351041..1351685 | + | 645 | WP_227350210.1 | Uma2 family endonuclease | - |
NMG85_RS05870 (PCC7805_01181) | 1351728..1352018 | - | 291 | WP_052338730.1 | hypothetical protein | - |
NMG85_RS05875 (PCC7805_01182) | 1352098..1353270 | - | 1173 | WP_254034382.1 | transposase | - |
NMG85_RS05880 (PCC7805_01184) | 1353484..1353855 | - | 372 | WP_026794176.1 | nucleotidyltransferase domain-containing protein | - |
NMG85_RS05885 (PCC7805_01185) | 1353852..1354301 | - | 450 | WP_042152432.1 | DUF29 domain-containing protein | - |
NMG85_RS05890 (PCC7805_01186) | 1354647..1355375 | - | 729 | WP_235751126.1 | Uma2 family endonuclease | - |
NMG85_RS05895 (PCC7805_01187) | 1355590..1355925 | - | 336 | WP_026786450.1 | DUF5615 family PIN-like protein | Toxin |
NMG85_RS05900 (PCC7805_01188) | 1355922..1356152 | - | 231 | WP_026786451.1 | DUF433 domain-containing protein | Antitoxin |
NMG85_RS05905 (PCC7805_01189) | 1356154..1356294 | - | 141 | WP_227366195.1 | hypothetical protein | - |
NMG85_RS05910 (PCC7805_01190) | 1356695..1357096 | - | 402 | WP_227366197.1 | type II toxin-antitoxin system VapC family toxin | - |
NMG85_RS05915 (PCC7805_01191) | 1357250..1357549 | - | 300 | WP_026797899.1 | hypothetical protein | - |
NMG85_RS05920 (PCC7805_01192) | 1358011..1358217 | + | 207 | WP_141295995.1 | hypothetical protein | - |
NMG85_RS05925 (PCC7805_01193) | 1358261..1358482 | + | 222 | WP_026786454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
NMG85_RS05930 (PCC7805_01194) | 1358536..1360152 | + | 1617 | WP_254034383.1 | tetratricopeptide repeat protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1352098..1353270 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12268.99 Da Isoelectric Point: 3.9823
>T289974 WP_026786450.1 NZ_LR882950:c1355925-1355590 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
Download Length: 336 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1JI02 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1J1JJG5 |