Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
| Location | 1809423..1809985 | Replicon | chromosome |
| Accession | NZ_LR882944 | ||
| Organism | Planktothrix agardhii strain No.365 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1J1JI02 |
| Locus tag | NMG87_RS07750 | Protein ID | WP_026786450.1 |
| Coordinates | 1809423..1809758 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1J1JJG5 |
| Locus tag | NMG87_RS07755 | Protein ID | WP_026786451.1 |
| Coordinates | 1809755..1809985 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMG87_RS07720 (NO365_01562) | 1804606..1806093 | - | 1488 | WP_254033424.1 | FkbM family methyltransferase | - |
| NMG87_RS07725 (NO365_01563) | 1806181..1806825 | + | 645 | WP_254033425.1 | Uma2 family endonuclease | - |
| NMG87_RS07730 (NO365_01564) | 1806868..1807296 | - | 429 | WP_227366191.1 | hypothetical protein | - |
| NMG87_RS07735 (NO365_01565) | 1807317..1807688 | - | 372 | WP_026794176.1 | nucleotidyltransferase domain-containing protein | - |
| NMG87_RS07740 (NO365_01566) | 1807685..1808134 | - | 450 | WP_036833930.1 | DUF29 domain-containing protein | - |
| NMG87_RS07745 (NO365_01567) | 1808480..1809208 | - | 729 | WP_254033426.1 | Uma2 family endonuclease | - |
| NMG87_RS07750 (NO365_01568) | 1809423..1809758 | - | 336 | WP_026786450.1 | DUF5615 family PIN-like protein | Toxin |
| NMG87_RS07755 (NO365_01569) | 1809755..1809985 | - | 231 | WP_026786451.1 | DUF433 domain-containing protein | Antitoxin |
| NMG87_RS07760 (NO365_01570) | 1809987..1810127 | - | 141 | WP_227366195.1 | hypothetical protein | - |
| NMG87_RS07765 (NO365_01571) | 1810528..1810929 | - | 402 | WP_026786452.1 | type II toxin-antitoxin system VapC family toxin | - |
| NMG87_RS07770 (NO365_01573) | 1811082..1811381 | - | 300 | WP_026786453.1 | hypothetical protein | - |
| NMG87_RS07775 (NO365_01574) | 1811843..1812046 | + | 204 | WP_141296006.1 | hypothetical protein | - |
| NMG87_RS07780 (NO365_01575) | 1812087..1812314 | - | 228 | WP_141296003.1 | hypothetical protein | - |
| NMG87_RS07785 (NO365_01576) | 1812318..1812792 | - | 475 | Protein_1531 | type II toxin-antitoxin system VapC family toxin | - |
| NMG87_RS07790 (NO365_01577) | 1813321..1813527 | + | 207 | WP_141295995.1 | hypothetical protein | - |
| NMG87_RS07795 (NO365_01578) | 1813571..1813792 | + | 222 | WP_026786454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12268.99 Da Isoelectric Point: 3.9823
>T289972 WP_026786450.1 NZ_LR882944:c1809758-1809423 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J1JI02 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J1JJG5 |