Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 1809423..1809985 Replicon chromosome
Accession NZ_LR882944
Organism Planktothrix agardhii strain No.365

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMG87_RS07750 Protein ID WP_026786450.1
Coordinates 1809423..1809758 (-) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMG87_RS07755 Protein ID WP_026786451.1
Coordinates 1809755..1809985 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG87_RS07720 (NO365_01562) 1804606..1806093 - 1488 WP_254033424.1 FkbM family methyltransferase -
NMG87_RS07725 (NO365_01563) 1806181..1806825 + 645 WP_254033425.1 Uma2 family endonuclease -
NMG87_RS07730 (NO365_01564) 1806868..1807296 - 429 WP_227366191.1 hypothetical protein -
NMG87_RS07735 (NO365_01565) 1807317..1807688 - 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMG87_RS07740 (NO365_01566) 1807685..1808134 - 450 WP_036833930.1 DUF29 domain-containing protein -
NMG87_RS07745 (NO365_01567) 1808480..1809208 - 729 WP_254033426.1 Uma2 family endonuclease -
NMG87_RS07750 (NO365_01568) 1809423..1809758 - 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMG87_RS07755 (NO365_01569) 1809755..1809985 - 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMG87_RS07760 (NO365_01570) 1809987..1810127 - 141 WP_227366195.1 hypothetical protein -
NMG87_RS07765 (NO365_01571) 1810528..1810929 - 402 WP_026786452.1 type II toxin-antitoxin system VapC family toxin -
NMG87_RS07770 (NO365_01573) 1811082..1811381 - 300 WP_026786453.1 hypothetical protein -
NMG87_RS07775 (NO365_01574) 1811843..1812046 + 204 WP_141296006.1 hypothetical protein -
NMG87_RS07780 (NO365_01575) 1812087..1812314 - 228 WP_141296003.1 hypothetical protein -
NMG87_RS07785 (NO365_01576) 1812318..1812792 - 475 Protein_1531 type II toxin-antitoxin system VapC family toxin -
NMG87_RS07790 (NO365_01577) 1813321..1813527 + 207 WP_141295995.1 hypothetical protein -
NMG87_RS07795 (NO365_01578) 1813571..1813792 + 222 WP_026786454.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289972 WP_026786450.1 NZ_LR882944:c1809758-1809423 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289972 WP_026786451.1 NZ_LR882944:c1809985-1809755 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References