Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-UPF0150
Location 1451982..1452418 Replicon chromosome
Accession NZ_LR882944
Organism Planktothrix agardhii strain No.365

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NMG87_RS06065 Protein ID WP_083624195.1
Coordinates 1451982..1452203 (-) Length 74 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NMG87_RS06070 Protein ID WP_199918700.1
Coordinates 1452200..1452418 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG87_RS06020 (NO365_01220) 1447292..1448200 - 909 WP_227366019.1 pentapeptide repeat-containing protein -
NMG87_RS06025 (NO365_01221) 1448376..1449296 - 921 WP_042153018.1 glutaminase A -
NMG87_RS06035 (NO365_01223) 1449791..1450006 - 216 WP_042153017.1 hypothetical protein -
NMG87_RS06040 (NO365_01224) 1450119..1450478 - 360 WP_042153014.1 hypothetical protein -
NMG87_RS06045 (NO365_01225) 1450465..1450794 - 330 WP_227350328.1 type II toxin-antitoxin system RelE/ParE family toxin -
NMG87_RS06050 (NO365_01226) 1450943..1451155 + 213 WP_083622512.1 hypothetical protein -
NMG87_RS06055 (NO365_01227) 1451152..1451538 + 387 WP_227382606.1 type II toxin-antitoxin system VapC family toxin -
NMG87_RS06060 (NO365_01228) 1451698..1451916 - 219 WP_254033365.1 hypothetical protein -
NMG87_RS06065 (NO365_01229) 1451982..1452203 - 222 WP_083624195.1 type II toxin-antitoxin system HicA family toxin Toxin
NMG87_RS06070 (NO365_01230) 1452200..1452418 - 219 WP_199918700.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NMG87_RS06075 (NO365_01231) 1452637..1454448 - 1812 WP_254033366.1 serine/threonine-protein kinase -
NMG87_RS06080 (NO365_01232) 1454641..1455510 - 870 WP_254033367.1 lipoyl synthase -
NMG87_RS06090 (NO365_01234) 1455742..1455942 - 201 WP_235751216.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(9-64)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-65)


Sequences

Toxin        


Download         Length: 74 a.a.        Molecular weight: 8226.64 Da        Isoelectric Point: 10.6668

>T289971 WP_083624195.1 NZ_LR882944:c1452203-1451982 [Planktothrix agardhii]
MSKLPRISGKECVKALEKVGFYLRRQQGSHLILRRNEPLTQVVVPNHSELDKGTLRSIIRGAGLSVDDFIQLL

Download         Length: 222 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 7960.16 Da        Isoelectric Point: 3.8237

>AT289971 WP_199918700.1 NZ_LR882944:c1452418-1452200 [Planktothrix agardhii]
MIRRVTIYSGEDGYWVVECPSLPGCVSQGKTQEEALINIKEAIQGYILALEEDGLPVPLENVETLENLLLVV

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References