Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 258956..259612 Replicon chromosome
Accession NZ_LR882944
Organism Planktothrix agardhii strain No.365

Toxin (Protein)


Gene name vapC Uniprot ID A0A4P5ZG20
Locus tag NMG87_RS01090 Protein ID WP_026798539.1
Coordinates 259214..259612 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1J9N3
Locus tag NMG87_RS01085 Protein ID WP_026795934.1
Coordinates 258956..259201 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG87_RS01045 (NO365_00219) 254629..255324 + 696 WP_026785406.1 response regulator transcription factor -
NMG87_RS01050 (NO365_00220) 255497..256060 + 564 WP_227350526.1 DUF192 domain-containing protein -
NMG87_RS01055 (NO365_00221) 256717..256932 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMG87_RS01060 257075..257230 - 156 WP_254033171.1 hypothetical protein -
NMG87_RS01065 (NO365_00224) 257501..257821 + 321 WP_237157247.1 type II toxin-antitoxin system VapC family toxin -
NMG87_RS01070 257828..258052 - 225 WP_235751406.1 hypothetical protein -
NMG87_RS01075 (NO365_00226) 258119..258523 - 405 WP_026785412.1 PIN domain-containing protein -
NMG87_RS01080 (NO365_00227) 258526..258774 - 249 WP_036831938.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NMG87_RS01085 (NO365_00228) 258956..259201 + 246 WP_026795934.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG87_RS01090 (NO365_00229) 259214..259612 + 399 WP_026798539.1 type II toxin-antitoxin system VapC family toxin Toxin
NMG87_RS01095 (NO365_00230) 259769..260152 - 384 WP_026785416.1 type II toxin-antitoxin system VapC family toxin -
NMG87_RS01100 (NO365_00231) 260145..260387 - 243 WP_254033172.1 hypothetical protein -
NMG87_RS01105 (NO365_00232) 260627..261220 - 594 WP_027255350.1 hypothetical protein -
NMG87_RS01110 (NO365_00233) 261434..262819 + 1386 WP_254033173.1 NB-ARC domain-containing protein -
NMG87_RS01115 (NO365_00234) 262850..263236 - 387 WP_227365720.1 type II toxin-antitoxin system VapC family toxin -
NMG87_RS01120 (NO365_00235) 263238..263480 - 243 WP_227365722.1 hypothetical protein -
NMG87_RS01125 (NO365_00236) 263711..264604 - 894 WP_254033174.1 acetylglutamate kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15305.73 Da        Isoelectric Point: 5.1406

>T289970 WP_026798539.1 NZ_LR882944:259214-259612 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEIKA
PHALRSSALPLHHRDPFDRMLIAQAQIENMTLVSADSIFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9077.41 Da        Isoelectric Point: 4.5358

>AT289970 WP_026795934.1 NZ_LR882944:258956-259201 [Planktothrix agardhii]
MAKLQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAF
E

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P5ZG20

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1J9N3

References