Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 2781731..2782293 Replicon chromosome
Accession NZ_LR882938
Organism Planktothrix agardhii strain No.2A

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMG72_RS12340 Protein ID WP_026786450.1
Coordinates 2781958..2782293 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMG72_RS12335 Protein ID WP_026786451.1
Coordinates 2781731..2781961 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG72_RS12305 (NO2A_02465) 2777256..2778683 + 1428 WP_254030401.1 tetratricopeptide repeat protein -
NMG72_RS12310 (NO2A_02466) 2779165..2779608 + 444 WP_227397582.1 type II toxin-antitoxin system VapC family toxin -
NMG72_RS12315 2779678..2779833 - 156 WP_227397583.1 hypothetical protein -
NMG72_RS12320 (NO2A_02467) 2780344..2780643 + 300 WP_026797899.1 hypothetical protein -
NMG72_RS12325 (NO2A_02469) 2780787..2781188 + 402 WP_227366197.1 type II toxin-antitoxin system VapC family toxin -
NMG72_RS12330 (NO2A_02470) 2781589..2781729 + 141 WP_227357797.1 hypothetical protein -
NMG72_RS12335 (NO2A_02471) 2781731..2781961 + 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMG72_RS12340 (NO2A_02472) 2781958..2782293 + 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMG72_RS12345 (NO2A_02473) 2782508..2783236 + 729 WP_227397584.1 Uma2 family endonuclease -
NMG72_RS12350 (NO2A_02474) 2783582..2784031 + 450 WP_042152432.1 DUF29 domain-containing protein -
NMG72_RS12355 (NO2A_02475) 2784028..2784399 + 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMG72_RS12360 (NO2A_02476) 2784471..2784848 + 378 WP_254030402.1 hypothetical protein -
NMG72_RS12365 (NO2A_02477) 2784891..2785535 - 645 WP_227350210.1 Uma2 family endonuclease -
NMG72_RS12370 (NO2A_02478) 2785623..2786816 + 1194 WP_227397586.1 FkbM family methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289967 WP_026786450.1 NZ_LR882938:2781958-2782293 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289967 WP_026786451.1 NZ_LR882938:2781731-2781961 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References