Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 546233..546876 Replicon chromosome
Accession NZ_LR882938
Organism Planktothrix agardhii strain No.2A

Toxin (Protein)


Gene name vapC Uniprot ID A0A073CFP1
Locus tag NMG72_RS02390 Protein ID WP_042153936.1
Coordinates 546478..546876 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NMG72_RS02385 Protein ID WP_042157396.1
Coordinates 546233..546481 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMG72_RS02350 (NO2A_00473) 541827..542744 + 918 WP_042157400.1 NAD(+) kinase -
NMG72_RS02355 (NO2A_00474) 542859..543554 + 696 WP_026785406.1 response regulator transcription factor -
NMG72_RS02360 (NO2A_00475) 543727..544290 + 564 WP_227350526.1 DUF192 domain-containing protein -
NMG72_RS02365 (NO2A_00476) 544947..545162 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMG72_RS02370 545305..545460 - 156 WP_167541238.1 hypothetical protein -
NMG72_RS02375 (NO2A_00478) 545459..545734 + 276 WP_227350525.1 hypothetical protein -
NMG72_RS02380 (NO2A_00479) 545731..546174 + 444 WP_227397769.1 type II toxin-antitoxin system VapC family toxin -
NMG72_RS02385 (NO2A_00480) 546233..546481 + 249 WP_042157396.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMG72_RS02390 (NO2A_00481) 546478..546876 + 399 WP_042153936.1 type II toxin-antitoxin system VapC family toxin Toxin
NMG72_RS02395 (NO2A_00482) 547084..547314 + 231 WP_227381613.1 DUF433 domain-containing protein -
NMG72_RS02400 (NO2A_00483) 547397..547549 - 153 WP_227350523.1 PIN domain-containing protein -
NMG72_RS02405 (NO2A_00484) 547551..547772 - 222 WP_227381614.1 DUF2281 domain-containing protein -
NMG72_RS02410 (NO2A_00485) 547987..548577 - 591 WP_026796356.1 hypothetical protein -
NMG72_RS02415 (NO2A_00486) 548791..549360 + 570 WP_042153930.1 hypothetical protein -
NMG72_RS02420 (NO2A_00487) 549401..550294 - 894 WP_042153928.1 acetylglutamate kinase -
NMG72_RS02425 (NO2A_00488) 550374..550880 - 507 WP_235751400.1 rod shape-determining protein MreD -
NMG72_RS02430 (NO2A_00489) 550942..551718 - 777 WP_042153924.1 rod shape-determining protein MreC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(8-42)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15297.68 Da        Isoelectric Point: 4.6761

>T289966 WP_042153936.1 NZ_LR882938:546478-546876 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEITA
PHALRSSALPLHHRDPFDRMLIAQAQIEDMTLVSADSMFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9175.37 Da        Isoelectric Point: 4.2702

>AT289966 WP_042157396.1 NZ_LR882938:546233-546481 [Planktothrix agardhii]
IQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAFEGN
EQ

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A073CFP1

Antitoxin

Source ID Structure

References