Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN-PHD
Location 3976674..3977317 Replicon chromosome
Accession NZ_LR882934
Organism Planktothrix agardhii strain NIVA-CYA126/8

Toxin (Protein)


Gene name vapC Uniprot ID A0A073CFP1
Locus tag NMK38_RS18010 Protein ID WP_042153936.1
Coordinates 3976919..3977317 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NMK38_RS18005 Protein ID WP_042157396.1
Coordinates 3976674..3976922 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK38_RS17970 (NIVACYA_03594) 3972217..3973134 + 918 WP_042157400.1 NAD(+) kinase -
NMK38_RS17975 (NIVACYA_03595) 3973249..3973944 + 696 WP_026785406.1 response regulator transcription factor -
NMK38_RS17980 (NIVACYA_03596) 3974168..3974731 + 564 WP_227350526.1 DUF192 domain-containing protein -
NMK38_RS17985 (NIVACYA_03597) 3975388..3975603 + 216 WP_036831945.1 DUF2949 domain-containing protein -
NMK38_RS17990 3975746..3975901 - 156 WP_167541238.1 hypothetical protein -
NMK38_RS17995 (NIVACYA_03599) 3975900..3976175 + 276 WP_227350525.1 hypothetical protein -
NMK38_RS18000 (NIVACYA_03600) 3976172..3976615 + 444 WP_042153938.1 type II toxin-antitoxin system VapC family toxin -
NMK38_RS18005 (NIVACYA_03601) 3976674..3976922 + 249 WP_042157396.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NMK38_RS18010 (NIVACYA_03602) 3976919..3977317 + 399 WP_042153936.1 type II toxin-antitoxin system VapC family toxin Toxin
NMK38_RS18015 (NIVACYA_03603) 3977525..3977755 + 231 WP_042153934.1 DUF433 domain-containing protein -
NMK38_RS18020 (NIVACYA_03604) 3977838..3977990 - 153 WP_227350523.1 PIN domain-containing protein -
NMK38_RS18025 (NIVACYA_03605) 3977992..3978213 - 222 WP_042153932.1 DUF2281 domain-containing protein -
NMK38_RS18030 (NIVACYA_03606) 3978428..3979018 - 591 WP_026796356.1 hypothetical protein -
NMK38_RS18035 (NIVACYA_03607) 3979232..3979801 + 570 WP_042153930.1 hypothetical protein -
NMK38_RS18040 (NIVACYA_03608) 3979842..3980735 - 894 WP_042153928.1 acetylglutamate kinase -
NMK38_RS18045 (NIVACYA_03609) 3980815..3981354 - 540 WP_042153926.1 rod shape-determining protein MreD -
NMK38_RS18050 (NIVACYA_03610) 3981383..3982159 - 777 WP_042153924.1 rod shape-determining protein MreC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(4-129)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(8-42)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15297.68 Da        Isoelectric Point: 4.6761

>T289963 WP_042153936.1 NZ_LR882934:3976919-3977317 [Planktothrix agardhii]
VKLLLDTQCWLWWFAQPERLNQEVIAQIADESNELWFSVASVWEIGIKVAIRKLPLPEPIDTYISSRMVQLDMRYLEITA
PHALRSSALPLHHRDPFDRMLIAQAQIEDMTLVSADSMFKQYSDISVLWAAN

Download         Length: 399 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9175.37 Da        Isoelectric Point: 4.2702

>AT289963 WP_042157396.1 NZ_LR882934:3976674-3976922 [Planktothrix agardhii]
IQIENLPNDFKKNLSELLSRVELGEEIIISNQGVAIAKLIPFRPSSNRRASLGQDQGKFIIPDDFNEPLPQEILAAFEGN
EQ

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A073CFP1

Antitoxin

Source ID Structure

References