Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 1404887..1405449 Replicon chromosome
Accession NZ_LR882934
Organism Planktothrix agardhii strain NIVA-CYA126/8

Toxin (Protein)


Gene name vapC Uniprot ID A0A1J1JI02
Locus tag NMK38_RS06465 Protein ID WP_026786450.1
Coordinates 1405114..1405449 (+) Length 112 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A1J1JJG5
Locus tag NMK38_RS06460 Protein ID WP_026786451.1
Coordinates 1404887..1405117 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMK38_RS06430 (NIVACYA_01275) 1401373..1401702 - 330 WP_042152421.1 MazF family transcriptional regulator -
NMK38_RS06435 (NIVACYA_01276) 1401680..1401883 - 204 WP_026797898.1 hypothetical protein -
NMK38_RS06440 (NIVACYA_01277) 1402345..1402644 + 300 WP_026786453.1 hypothetical protein -
NMK38_RS06445 (NIVACYA_01278) 1402880..1403800 + 921 WP_042154442.1 transposase family protein -
NMK38_RS06450 (NIVACYA_01279) 1403982..1404344 + 363 WP_042152425.1 PIN domain-containing protein -
NMK38_RS06455 (NIVACYA_01280) 1404745..1404885 + 141 WP_227366195.1 hypothetical protein -
NMK38_RS06460 (NIVACYA_01281) 1404887..1405117 + 231 WP_026786451.1 DUF433 domain-containing protein Antitoxin
NMK38_RS06465 (NIVACYA_01282) 1405114..1405449 + 336 WP_026786450.1 DUF5615 family PIN-like protein Toxin
NMK38_RS06470 (NIVACYA_01283) 1405667..1406392 + 726 WP_042152429.1 Uma2 family endonuclease -
NMK38_RS06475 (NIVACYA_01284) 1406738..1407187 + 450 WP_042152432.1 DUF29 domain-containing protein -
NMK38_RS06480 (NIVACYA_01285) 1407184..1407555 + 372 WP_026794176.1 nucleotidyltransferase domain-containing protein -
NMK38_RS06485 (NIVACYA_01286) 1407576..1408004 + 429 WP_227366191.1 hypothetical protein -
NMK38_RS06490 (NIVACYA_01287) 1408047..1408691 - 645 WP_026794177.1 Uma2 family endonuclease -
NMK38_RS06495 (NIVACYA_01288) 1408779..1410287 + 1509 WP_158442873.1 FkbM family methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(1-78)

Antitoxin

Protein of unknown function DUF433

(10-65)


Sequences

Toxin        


Download         Length: 112 a.a.        Molecular weight: 12268.99 Da        Isoelectric Point: 3.9823

>T289960 WP_026786450.1 NZ_LR882934:1405114-1405449 [Planktothrix agardhii]
MNFWIDAQLPPSLANWLVETFNVNATAIRDLGLRDAEDIEIFNAARNPGTVIVSKDSDFVELVTRLGTPPQILWLTCGNV
TNRNLRLILSNTFAEALPMLEAGEAIVEISD

Download         Length: 336 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8535.94 Da        Isoelectric Point: 6.2230

>AT289960 WP_026786451.1 NZ_LR882934:1404887-1405117 [Planktothrix agardhii]
MTAKSLLNRITYNPRQCGGRPCIRGMRIRVSDILEMLAENVSSGEILEDFPDLEAEDIQACLLFAARRTNIPKLTV

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1J1JI02

Antitoxin

Source ID Structure
AlphaFold DB A0A1J1JJG5

References