Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 3788337..3789004 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O50411 |
| Locus tag | JOA04_RS17610 | Protein ID | WP_003417916.1 |
| Coordinates | 3788337..3788729 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
| Locus tag | JOA04_RS17615 | Protein ID | WP_003912214.1 |
| Coordinates | 3788729..3789004 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS17595 | 3783707..3785545 | - | 1839 | WP_003918607.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| JOA04_RS17600 | 3785542..3786531 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| JOA04_RS17605 | 3786531..3787583 | - | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
| JOA04_RS17610 | 3788337..3788729 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JOA04_RS17615 | 3788729..3789004 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JOA04_RS17620 | 3789216..3790557 | + | 1342 | Protein_3482 | ISNCY family transposase | - |
| JOA04_RS17625 | 3790747..3793008 | + | 2262 | WP_031667118.1 | PE family protein | - |
| JOA04_RS17630 | 3793079..3793951 | - | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3789880..3790557 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T289958 WP_003417916.1 NZ_LR882500:c3788729-3788337 [Mycobacterium tuberculosis variant microti]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BXS8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E8U8S7 |