Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 3761214..3761743 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TI95 |
Locus tag | JOA04_RS17490 | Protein ID | WP_003417760.1 |
Coordinates | 3761486..3761743 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0TI94 |
Locus tag | JOA04_RS17485 | Protein ID | WP_003417757.1 |
Coordinates | 3761214..3761489 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS17465 | 3758012..3759449 | - | 1438 | Protein_3451 | FAD-binding oxidoreductase | - |
JOA04_RS17470 | 3759552..3759941 | + | 390 | WP_003417745.1 | DUF732 domain-containing protein | - |
JOA04_RS17475 | 3759955..3760248 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
JOA04_RS17480 | 3760245..3761090 | - | 846 | WP_003417751.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
JOA04_RS17485 | 3761214..3761489 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
JOA04_RS17490 | 3761486..3761743 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
JOA04_RS17495 | 3761785..3762975 | + | 1191 | WP_202582083.1 | NADH:flavin oxidoreductase | - |
JOA04_RS17500 | 3763092..3763460 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
JOA04_RS17505 | 3763457..3764008 | - | 552 | WP_105799777.1 | pentapeptide repeat protein MfpA | - |
JOA04_RS17510 | 3764015..3764596 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
JOA04_RS17515 | 3764577..3764945 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
JOA04_RS17520 | 3764923..3765315 | - | 393 | WP_003417776.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T289957 WP_003417760.1 NZ_LR882500:3761486-3761743 [Mycobacterium tuberculosis variant microti]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|