Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3711921..3712595 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag JOA04_RS17325 Protein ID WP_105799814.1
Coordinates 3711921..3712349 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag JOA04_RS17330 Protein ID WP_003417286.1
Coordinates 3712353..3712595 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS17300 3707743..3708144 - 402 WP_003417264.1 cytidine deaminase -
JOA04_RS17305 3708285..3708719 + 435 WP_003900017.1 succinate dehydrogenase, cytochrome b556 subunit -
JOA04_RS17310 3708716..3709150 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
JOA04_RS17315 3709279..3711051 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
JOA04_RS17320 3711051..3711842 + 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
JOA04_RS17325 3711921..3712349 - 429 WP_105799814.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS17330 3712353..3712595 - 243 WP_003417286.1 ribbon-helix-helix domain-containing protein Antitoxin
JOA04_RS17335 3712717..3713331 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
JOA04_RS17340 3713328..3713993 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
JOA04_RS17345 3713994..3714527 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
JOA04_RS17350 3714524..3714898 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
JOA04_RS17355 3714995..3716059 - 1065 WP_003913037.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-127)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15751.08 Da        Isoelectric Point: 8.3191

>T289956 WP_105799814.1 NZ_LR882500:c3712349-3711921 [Mycobacterium tuberculosis variant microti]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT289956 WP_003417286.1 NZ_LR882500:c3712595-3712353 [Mycobacterium tuberculosis variant microti]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References