Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3182537..3183224 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | JOA04_RS14960 | Protein ID | WP_003414624.1 |
Coordinates | 3182781..3183224 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | JOA04_RS14955 | Protein ID | WP_003414620.1 |
Coordinates | 3182537..3182794 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS14935 | 3177857..3178711 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
JOA04_RS14940 | 3178767..3179930 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
JOA04_RS14945 | 3179947..3181161 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
JOA04_RS14950 | 3181169..3182410 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
JOA04_RS14955 | 3182537..3182794 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JOA04_RS14960 | 3182781..3183224 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JOA04_RS14965 | 3183304..3183966 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
JOA04_RS14970 | 3184062..3184253 | + | 192 | WP_105799616.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
JOA04_RS14975 | 3184585..3186333 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
JOA04_RS14980 | 3186429..3187010 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
JOA04_RS14985 | 3187110..3187376 | + | 267 | WP_031652375.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T289954 WP_003414624.1 NZ_LR882500:3182781-3183224 [Mycobacterium tuberculosis variant microti]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|