Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3136019..3136623 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag JOA04_RS14730 Protein ID WP_003414492.1
Coordinates 3136019..3136411 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag JOA04_RS14735 Protein ID WP_003414495.1
Coordinates 3136408..3136623 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS14700 3131169..3131957 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
JOA04_RS14705 3132291..3132836 - 546 WP_003904931.1 DUF1802 family protein -
JOA04_RS14710 3133108..3133992 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
JOA04_RS14715 3133995..3134882 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
JOA04_RS14720 3135187..3135732 - 546 WP_003899500.1 DUF1802 family protein -
JOA04_RS14725 3135729..3135998 - 270 WP_003414489.1 DUF2277 family protein -
JOA04_RS14730 3136019..3136411 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS14735 3136408..3136623 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JOA04_RS14740 3136670..3137419 + 750 WP_003414497.1 enoyl-CoA hydratase -
JOA04_RS14745 3137498..3138580 - 1083 WP_003414499.1 ABC transporter ATP-binding protein -
JOA04_RS14750 3138573..3139883 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
JOA04_RS14755 3139886..3140713 - 828 WP_202582056.1 carbohydrate ABC transporter permease -
JOA04_RS14760 3140710..3141621 - 912 WP_105799902.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T289952 WP_003414492.1 NZ_LR882500:c3136411-3136019 [Mycobacterium tuberculosis variant microti]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT289952 WP_003414495.1 NZ_LR882500:c3136623-3136408 [Mycobacterium tuberculosis variant microti]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References