Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3113614..3114184 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | JOA04_RS14590 | Protein ID | WP_003414166.1 |
| Coordinates | 3113614..3113970 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | JOA04_RS14595 | Protein ID | WP_003901465.1 |
| Coordinates | 3113954..3114184 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS14570 | 3109063..3110751 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| JOA04_RS14575 | 3110755..3111081 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| JOA04_RS14580 | 3111254..3111844 | + | 591 | WP_031656198.1 | DUF3558 family protein | - |
| JOA04_RS14585 | 3111863..3113512 | + | 1650 | WP_105799646.1 | CocE/NonD family hydrolase | - |
| JOA04_RS14590 | 3113614..3113970 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| JOA04_RS14595 | 3113954..3114184 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
| JOA04_RS14600 | 3114227..3115270 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| JOA04_RS14605 | 3115461..3115736 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
| JOA04_RS14610 | 3115912..3116166 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| JOA04_RS14615 | 3116314..3116718 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| JOA04_RS14620 | 3116715..3116906 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| JOA04_RS14625 | 3116970..3118259 | + | 1290 | Protein_2887 | transposase family protein | - |
| JOA04_RS14630 | 3118493..3118750 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| JOA04_RS14635 | 3118855..3119166 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T289950 WP_003414166.1 NZ_LR882500:c3113970-3113614 [Mycobacterium tuberculosis variant microti]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|