Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2933568..2934282 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag JOA04_RS13545 Protein ID WP_003413460.1
Coordinates 2933842..2934282 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag JOA04_RS13540 Protein ID WP_003413456.1
Coordinates 2933568..2933855 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS13505 2928990..2929235 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JOA04_RS13510 2929232..2929636 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
JOA04_RS13515 2929853..2930473 + 621 WP_003413441.1 DUF4178 domain-containing protein -
JOA04_RS13520 2930484..2930978 + 495 WP_003413444.1 DUF2617 family protein -
JOA04_RS13525 2930975..2931406 + 432 WP_003413445.1 DUF4247 domain-containing protein -
JOA04_RS13530 2931431..2931889 + 459 WP_193441927.1 DUF350 domain-containing protein -
JOA04_RS13535 2931886..2933457 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
JOA04_RS13540 2933568..2933855 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
JOA04_RS13545 2933842..2934282 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS13550 2934303..2935058 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
JOA04_RS13555 2935191..2935787 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
JOA04_RS13560 2935795..2936640 - 846 WP_003413466.1 acyl-CoA thioesterase II -
JOA04_RS13565 2936669..2937568 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
JOA04_RS13570 2937696..2938370 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T289946 WP_003413460.1 NZ_LR882500:2933842-2934282 [Mycobacterium tuberculosis variant microti]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT289946 WP_003413456.1 NZ_LR882500:2933568-2933855 [Mycobacterium tuberculosis variant microti]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References