Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2871626..2872335 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag JOA04_RS13260 Protein ID WP_003413164.1
Coordinates 2871626..2872039 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag JOA04_RS13265 Protein ID WP_003413167.1
Coordinates 2872078..2872335 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS13230 2866679..2867884 - 1206 WP_003413027.1 chorismate synthase -
JOA04_RS13235 2867992..2868306 + 315 WP_009937839.1 hypothetical protein -
JOA04_RS13240 2868602..2869813 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
JOA04_RS13245 2869940..2870599 + 660 WP_031719937.1 LppA family lipoprotein -
JOA04_RS13250 2870596..2871258 + 663 WP_052624433.1 hypothetical protein -
JOA04_RS13255 2871255..2871533 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
JOA04_RS13260 2871626..2872039 + 414 WP_003413164.1 PIN domain nuclease Toxin
JOA04_RS13265 2872078..2872335 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
JOA04_RS13270 2872332..2872709 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
JOA04_RS13275 2872725..2873099 - 375 WP_003413177.1 hypothetical protein -
JOA04_RS13280 2873199..2873594 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
JOA04_RS13285 2873591..2873836 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
JOA04_RS13290 2874247..2874666 - 420 WP_003413190.1 A24 family peptidase -
JOA04_RS13295 2874678..2875487 - 810 WP_003413193.1 shikimate dehydrogenase -
JOA04_RS13300 2875484..2876755 - 1272 WP_202586489.1 endolytic transglycosylase MltG -
JOA04_RS13305 2876748..2877260 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T289943 WP_003413164.1 NZ_LR882500:2871626-2872039 [Mycobacterium tuberculosis variant microti]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT289943 WP_003413167.1 NZ_LR882500:2872078-2872335 [Mycobacterium tuberculosis variant microti]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References