Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2857738..2858378 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag JOA04_RS13175 Protein ID WP_003412970.1
Coordinates 2857738..2858157 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag JOA04_RS13180 Protein ID WP_202586488.1
Coordinates 2858154..2858378 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS13145 2853323..2854045 - 723 WP_003412957.1 DUF1906 domain-containing protein -
JOA04_RS13150 2854562..2854789 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
JOA04_RS13155 2854786..2855187 + 402 WP_003412963.1 PIN domain-containing protein -
JOA04_RS13160 2855222..2856142 - 921 WP_003412965.1 restriction endonuclease -
JOA04_RS13165 2856483..2856728 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JOA04_RS13170 2856787..2857737 + 951 WP_003911916.1 Lsr2 family protein -
JOA04_RS13175 2857738..2858157 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS13180 2858154..2858378 - 225 WP_202586488.1 antitoxin Antitoxin
JOA04_RS13185 2858409..2861253 - 2845 Protein_2603 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
JOA04_RS13190 2861325..2861726 - 402 WP_003412981.1 hypothetical protein -
JOA04_RS13195 2861726..2862196 - 471 WP_003412985.1 transcription antitermination factor NusB -
JOA04_RS13200 2862199..2862762 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T289942 WP_003412970.1 NZ_LR882500:c2858157-2857738 [Mycobacterium tuberculosis variant microti]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8007.96 Da        Isoelectric Point: 4.0057

>AT289942 WP_202586488.1 NZ_LR882500:c2858378-2858154 [Mycobacterium tuberculosis variant microti]
MRTTLQIDDDILEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure

References