289940

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2408196..2408725 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag JOA04_RS11100 Protein ID WP_003411124.1
Coordinates 2408196..2408513 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag JOA04_RS11105 Protein ID WP_003411127.1
Coordinates 2408510..2408725 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS11070 2403217..2404293 + 1077 WP_003411110.1 hypothetical protein -
JOA04_RS11075 2404290..2404571 + 282 WP_055377560.1 hypothetical protein -
JOA04_RS11080 2404607..2405680 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
JOA04_RS11085 2405685..2406215 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
JOA04_RS11090 2406263..2407609 - 1347 WP_105799941.1 M20/M25/M40 family metallo-hydrolase -
JOA04_RS11100 2408196..2408513 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JOA04_RS11105 2408510..2408725 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
JOA04_RS11110 2408980..2410038 + 1059 WP_003411129.1 hypothetical protein -
JOA04_RS11115 2410168..2410524 - 357 WP_003411130.1 hypothetical protein -
JOA04_RS11120 2410619..2411401 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
JOA04_RS11125 2411669..2411959 - 291 WP_003900476.1 YggT family protein -
JOA04_RS11130 2412121..2412777 - 657 WP_003411133.1 cell division protein SepF -
JOA04_RS11135 2412843..2413619 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T289940 WP_003411124.1 NZ_LR882500:c2408513-2408196 [Mycobacterium tuberculosis variant microti]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT289940 WP_003411127.1 NZ_LR882500:c2408725-2408510 [Mycobacterium tuberculosis variant microti]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References