Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2371427..2372122 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | JOA04_RS10900 | Protein ID | WP_003410811.1 |
Coordinates | 2371427..2371861 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | JOA04_RS10905 | Protein ID | WP_003410814.1 |
Coordinates | 2371868..2372122 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS10890 | 2367581..2370622 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
JOA04_RS10895 | 2370615..2371448 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
JOA04_RS10900 | 2371427..2371861 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JOA04_RS10905 | 2371868..2372122 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
JOA04_RS10910 | 2372138..2372395 | - | 258 | WP_003410816.1 | hypothetical protein | - |
JOA04_RS10915 | 2373343..2373639 | + | 297 | WP_003410820.1 | PE family protein | - |
JOA04_RS10920 | 2373695..2374426 | + | 732 | WP_003900467.1 | PPE family protein | - |
JOA04_RS10925 | 2374966..2375712 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
JOA04_RS10930 | 2375709..2376584 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
JOA04_RS10935 | 2376581..2376775 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T289939 WP_003410811.1 NZ_LR882500:c2371861-2371427 [Mycobacterium tuberculosis variant microti]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |