Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2326169..2326805 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | JOA04_RS10695 | Protein ID | WP_003410654.1 |
Coordinates | 2326395..2326805 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | JOA04_RS10690 | Protein ID | WP_003410651.1 |
Coordinates | 2326169..2326402 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS10680 | 2322019..2322423 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
JOA04_RS10685 | 2322507..2326091 | - | 3585 | WP_105799686.1 | cobaltochelatase subunit CobN | - |
JOA04_RS10690 | 2326169..2326402 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
JOA04_RS10695 | 2326395..2326805 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
JOA04_RS10700 | 2326789..2327880 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
JOA04_RS10705 | 2327890..2328516 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
JOA04_RS10710 | 2328513..2330039 | + | 1527 | Protein_2119 | precorrin-2 C(20)-methyltransferase | - |
JOA04_RS10715 | 2329985..2331208 | - | 1224 | WP_105799664.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T289938 WP_003410654.1 NZ_LR882500:2326395-2326805 [Mycobacterium tuberculosis variant microti]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|