Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2258384..2259010 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | JOA04_RS10410 | Protein ID | WP_003410075.1 |
Coordinates | 2258612..2259010 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | JOA04_RS10405 | Protein ID | WP_019283586.1 |
Coordinates | 2258384..2258611 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS10395 | 2256423..2256767 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
JOA04_RS10400 | 2256956..2258125 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
JOA04_RS10405 | 2258384..2258611 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JOA04_RS10410 | 2258612..2259010 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
JOA04_RS10415 | 2259193..2259624 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
JOA04_RS10420 | 2259725..2260159 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
JOA04_RS10425 | 2260596..2260775 | - | 180 | Protein_2062 | hypothetical protein | - |
JOA04_RS10430 | 2260836..2261483 | + | 648 | WP_071854215.1 | transposase | - |
JOA04_RS10435 | 2261437..2262027 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
JOA04_RS10440 | 2262155..2263411 | - | 1257 | WP_003410095.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T289936 WP_003410075.1 NZ_LR882500:2258612-2259010 [Mycobacterium tuberculosis variant microti]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|