Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2208216..2208919 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | JOA04_RS10100 | Protein ID | WP_003409778.1 |
Coordinates | 2208216..2208545 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | JOA04_RS10105 | Protein ID | WP_003409780.1 |
Coordinates | 2208542..2208919 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS10080 | 2204600..2205669 | + | 1070 | Protein_1993 | epoxide hydrolase EphB | - |
JOA04_RS10085 | 2205666..2206181 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
JOA04_RS10090 | 2206178..2207239 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
JOA04_RS10095 | 2207236..2208006 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
JOA04_RS10100 | 2208216..2208545 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
JOA04_RS10105 | 2208542..2208919 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
JOA04_RS10110 | 2208916..2209506 | - | 591 | WP_003409784.1 | SEC-C domain-containing protein | - |
JOA04_RS10115 | 2209561..2210925 | + | 1365 | WP_003903691.1 | HNH endonuclease | - |
JOA04_RS10120 | 2211080..2211532 | - | 453 | WP_003899095.1 | lipoprotein | - |
JOA04_RS10125 | 2211596..2211997 | + | 402 | WP_003409869.1 | hypothetical protein | - |
JOA04_RS10130 | 2211990..2212172 | - | 183 | WP_003409870.1 | hypothetical protein | - |
JOA04_RS10135 | 2212286..2212636 | - | 351 | WP_003409871.1 | hypothetical protein | - |
JOA04_RS10140 | 2212647..2213549 | - | 903 | WP_003409874.1 | hypothetical protein | - |
JOA04_RS10145 | 2213570..2213761 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T289930 WP_003409778.1 NZ_LR882500:c2208545-2208216 [Mycobacterium tuberculosis variant microti]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT289930 WP_003409780.1 NZ_LR882500:c2208919-2208542 [Mycobacterium tuberculosis variant microti]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|