Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 1392379..1392938 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0THS1 |
| Locus tag | JOA04_RS06530 | Protein ID | WP_003898789.1 |
| Coordinates | 1392379..1392672 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0THS2 |
| Locus tag | JOA04_RS06535 | Protein ID | WP_003406322.1 |
| Coordinates | 1392669..1392938 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS06505 | 1387973..1388233 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
| JOA04_RS06510 | 1388230..1388661 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
| JOA04_RS06515 | 1388684..1390371 | - | 1688 | Protein_1284 | PE family protein | - |
| JOA04_RS06520 | 1390551..1391411 | + | 861 | WP_003406306.1 | hypothetical protein | - |
| JOA04_RS06525 | 1391492..1392322 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| JOA04_RS06530 | 1392379..1392672 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| JOA04_RS06535 | 1392669..1392938 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JOA04_RS06540 | 1393051..1396746 | - | 3696 | WP_003406323.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
| JOA04_RS06545 | 1396888..1397676 | - | 789 | WP_003406325.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T289923 WP_003898789.1 NZ_LR882500:c1392672-1392379 [Mycobacterium tuberculosis variant microti]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|