Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1387973..1388661 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0THR7 |
Locus tag | JOA04_RS06510 | Protein ID | WP_003406304.1 |
Coordinates | 1388230..1388661 (+) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0THR6 |
Locus tag | JOA04_RS06505 | Protein ID | WP_003406302.1 |
Coordinates | 1387973..1388233 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS06485 | 1383550..1384374 | + | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
JOA04_RS06490 | 1384379..1385560 | + | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
JOA04_RS06495 | 1385637..1386737 | - | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
JOA04_RS06500 | 1386908..1387897 | + | 990 | WP_003406301.1 | malate dehydrogenase | - |
JOA04_RS06505 | 1387973..1388233 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
JOA04_RS06510 | 1388230..1388661 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JOA04_RS06515 | 1388684..1390371 | - | 1688 | Protein_1284 | PE family protein | - |
JOA04_RS06520 | 1390551..1391411 | + | 861 | WP_003406306.1 | hypothetical protein | - |
JOA04_RS06525 | 1391492..1392322 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
JOA04_RS06530 | 1392379..1392672 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
JOA04_RS06535 | 1392669..1392938 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T289922 WP_003406304.1 NZ_LR882500:1388230-1388661 [Mycobacterium tuberculosis variant microti]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|