Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1243065..1243633 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag JOA04_RS05860 Protein ID WP_003405865.1
Coordinates 1243259..1243633 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag JOA04_RS05855 Protein ID WP_003405863.1
Coordinates 1243065..1243262 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS05835 1239106..1239744 - 639 WP_003898730.1 lipid droplet-associated protein -
JOA04_RS05840 1239834..1240841 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
JOA04_RS05845 1240858..1241841 - 984 WP_003898731.1 hypothetical protein -
JOA04_RS05850 1241904..1242977 + 1074 WP_105799741.1 redox-regulated ATPase YchF -
JOA04_RS05855 1243065..1243262 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
JOA04_RS05860 1243259..1243633 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS05865 1243836..1244534 + 699 WP_003898733.1 hypothetical protein -
JOA04_RS05870 1244652..1244837 + 186 WP_003901093.1 hypothetical protein -
JOA04_RS05875 1244764..1245039 - 276 WP_003405867.1 hypothetical protein -
JOA04_RS05880 1245282..1245605 + 324 WP_003405871.1 antibiotic biosynthesis monooxygenase -
JOA04_RS05885 1245620..1246330 - 711 WP_003911399.1 hypothetical protein -
JOA04_RS05890 1246352..1246561 + 210 WP_003911400.1 hypothetical protein -
JOA04_RS05895 1246513..1247220 - 708 Protein_1160 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T289921 WP_003405865.1 NZ_LR882500:1243259-1243633 [Mycobacterium tuberculosis variant microti]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT289921 WP_003405863.1 NZ_LR882500:1243065-1243262 [Mycobacterium tuberculosis variant microti]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References