Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 1016195..1016814 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | JOA04_RS04775 | Protein ID | WP_003404726.1 |
| Coordinates | 1016380..1016814 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
| Locus tag | JOA04_RS04770 | Protein ID | WP_003404724.1 |
| Coordinates | 1016195..1016374 (+) | Length | 60 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS04755 | 1011668..1013248 | + | 1581 | WP_003909313.1 | serine hydrolase | - |
| JOA04_RS04760 | 1013245..1015638 | + | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
| JOA04_RS04765 | 1015914..1016069 | + | 156 | WP_009938289.1 | hypothetical protein | - |
| JOA04_RS04770 | 1016195..1016374 | + | 180 | WP_003404724.1 | antitoxin | Antitoxin |
| JOA04_RS04775 | 1016380..1016814 | + | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
| JOA04_RS04780 | 1016912..1017685 | + | 774 | WP_003404735.1 | VOC family protein | - |
| JOA04_RS04785 | 1017750..1018199 | + | 450 | WP_003404738.1 | hypothetical protein | - |
| JOA04_RS04790 | 1018334..1018564 | - | 231 | WP_003898642.1 | hypothetical protein | - |
| JOA04_RS04795 | 1018731..1020239 | - | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
| JOA04_RS04800 | 1020241..1021479 | - | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T289917 WP_003404726.1 NZ_LR882500:1016380-1016814 [Mycobacterium tuberculosis variant microti]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|